KEGG   Arabidopsis thaliana (thale cress): AT3G13940
Entry
AT3G13940         CDS       T00041                                 
Name
(RefSeq) DNA binding / DNA-directed RNA polymerase
  KO
K03005  DNA-directed RNA polymerase I subunit RPA49
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G13940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G13940
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     AT3G13940
SSDB
Motif
Pfam: RNA_pol_I_A49
Other DBs
NCBI-GeneID: 820607
NCBI-ProteinID: NP_188010
TAIR: AT3G13940
UniProt: Q9LVK6 A0A7G2EPU5
Position
3:complement(4600422..4602582)
AA seq 442 aa
MEGEEKNDYRNEEEDFNTPQQLQKKQRKGKKIATETEDENEEDKRVTLKVTQVAERPDRI
SPIVAYFSTGYDPCKVDPKTGKRVHETPKVTVYKHKDDSKKRIQVVVSPPGARVEFVGTN
YTGEQAAMQTNTYRVGVFNREAKTLRILPVAHNKIIRLEPRVKAQETNEEEASGSAVVKE
LEELKTGERDRYNTKKAVTRDKKKRALYMGDDAATQKVLDGKLSELGVNTAALEGTSSTV
ARNIPPYNTAATTANEAYPLEKIIEKGDWSFLEDIYWLLQQETEAATEAYPVFVRNRLYR
LRDIKDDMKKQTVCGAATLLTHLVKFKDRNSMNGYDSAKDHKMPDIFRQKFNSMFKDSES
DRIPVDKINLLISYVLVLSLHVDNFMTDPEDIAKDLRISTVELRKHFLQLGCKFLKQNST
TVATLPTPLNFPEVNRRRRARK
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggaaggcgaagagaagaatgattatagaaacgaggaagaagatttcaatacaccacaa
caactacaaaagaagcaaaggaaagggaaaaaaatagcaacggaaacagaggatgaaaac
gaagaagacaagagagttactctcaaagtcacgcaagtcgccgagagacccgatagaatc
tctccgatcgtcgcctatttctctacaggatacgatccttgtaaagtagatccaaaaaca
ggcaagagagttcatgaaactcccaaggttactgtttacaagcataaggatgattctaag
aagaggattcaggttgttgtaagtcctccaggcgcaagagttgagttcgtcggaactaat
tacacaggcgagcaagctgctatgcagacgaatacttatagagttggtgtttttaataga
gaggctaaaactttgaggattcttcctgttgctcacaataagataatcagattggagcct
agagttaaagctcaagaaacaaatgaggaagaagcttcaggaagtgctgtcgtcaaagaa
cttgaagaactaaaaacaggagaacgcgatcgttataatacaaaaaaagctgttactcgg
gataagaagaagcgtgccttatatatgggagatgatgctgcgactcagaaggtccttgat
gggaaactaagtgagttaggtgttaacacagctgctcttgaaggcaccagttctactgtt
gcacgcaacattcctccttacaataccgctgcaacgactgcaaatgaagcttatccctta
gaaaagatcattgaaaagggggattggagttttcttgaagatatttactggcttctgcaa
caggaaactgaagcagcaactgaggcttaccctgtatttgtccgcaacagattgtacaga
ttgcgagatatcaaggacgatatgaaaaagcagacggtttgtggtgctgcaacgcttctc
acccatctggttaagttcaaggacagaaactcaatgaatggttacgattccgctaaagac
cacaagatgccagacatcttccgtcaaaaattcaacagcatgttcaaggattctgaatca
gataggatacctgttgacaagatcaaccttctgataagctacgttcttgtgctatccctt
cacgtggataatttcatgaccgatccagaagacatagcaaaagatctgaggataagcaca
gttgagctgaggaaacattttctacagcttggctgcaaattcctgaagcagaattctact
acggttgctaccttaccgacccctctcaatttcccggaggttaaccggaggcgcagggca
cgaaagtga

DBGET integrated database retrieval system