KEGG   Arabidopsis thaliana (thale cress): AT3G15620
Entry
AT3G15620         CDS       T00041                                 

Symbol
UVR3
Name
(RefSeq) DNA photolyase family protein
  KO
K02295  cryptochrome
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G15620 (UVR3)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    AT3G15620 (UVR3)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase BaffR-Tall_bind
Other DBs
NCBI-GeneID: 820804
NCBI-ProteinID: NP_566520
TAIR: AT3G15620
UniProt: O48652
Structure
PDB: 
3FY4

Position
3:complement(join(5293475..5293653,5293832..5293927,5294009..5294096,5294231..5294344,5294417..5294488,5294570..5294656,5294752..5294835,5294912..5295010,5295096..5295182,5295403..5295474,5295554..5295733,5295825..5295905,5296017..5296088,5296189..5296548))
AA seq 556 aa
MQRFCVCSPSSYRLNPITSMATGSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDP
HYMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQE
WKVKRLCFEYDTDPYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSY
QSFLKVAGEPSCAKSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGG
ESEALKRLTKSISDKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNI
YKDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRD
GKTGYPWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAI
NNGNWMWLSCSSFFYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPL
SVQTKANCIVGKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKLQK
DEHEESKIRNQRPKLK
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgcaacgattctgcgtctgttcaccttcaagttatcgtctcaatcccataacatcaatg
gctactggatccggttcactgatttggttccggaaaggtctccgggttcacgacaacccg
gctcttgaatacgcctcaaaaggttctgaatttatgtatccggtttttgttatcgacccg
cattatatggagtcagacccatctgcgttctctcccggttcgtctcgcgccggggtaaac
cggatccggttcttgcttgagagtctcaaggatctcgattctagcctgaagaaacttggt
tcacggttgcttgtttttaaaggtgaacctggcgaagtactagttcgttgcttgcaagag
tggaaggtgaagaggctttgctttgaatatgatacagatccgtattatcaagctttagat
gttaaggttaaggattatgcttcttcaactggagttgaggttttctctccagtgagccat
actctgttcaatcccgcacacattatagagaaaaacggtgggaagccacctttgagttat
caatcatttctgaaggttgctggggagccctcatgtgctaaatctgaacttgtgatgtct
tattcttcacttcctccaattggagatattggaaaccttggcatttcagaagtaccatct
cttgaggaacttggctacaaagatgatgaacaagctgattggactccttttagaggtggt
gaatcagaagccttaaaaagattgactaaatcaatcagtgataaggcatgggtggcaaac
tttgagaaaccaaagggtgatccatctgctttcttgaagcctgctactacagttatgtca
ccatatttgaaattcggatgcctttcttcgaggtacttttatcaatgccttcaaaatatt
tataaggatgttaaaaagcatacatcgccgccagtttctctcctggggcagttgttgtgg
cgagaatttttctataccactgcatttggaactcctaactttgacaaaatgaagggaaac
cggatctgcaaacagattccatggaacgaggatcatgctatgttggctgcttggagggac
ggtaagacaggatacccttggattgatgccatcatggttcagcttctgaaatggggttgg
atgcaccatctagcgcgtcactgtgtagcctgttttcttactcgtggggatctgttcata
cattgggaacaagggcgtgatgtgtttgagagacttctgatcgattcagactgggcaatc
aacaatggaaattggatgtggttatcatgttcgtcgttcttttaccagttcaaccgcatc
tactctcctatatctttcggaaagaagtatgatcctgatgggaagtacattaggcatttt
ctaccggtactgaaagatatgccaaagcaatatatatatgagccatggacagcaccattg
agcgttcaaactaaagcaaactgcatagtcgggaaggactacccaaagccaatggtattg
cacgattcagcaagcaaggagtgcaagaggaagatgggtgaagcatatgcattgaacaag
aagatggatggtaaagtagatgaagaaaatttgagggatttgaggagaaagcttcagaaa
gatgaacatgaagagtccaaaatcaggaaccaacgaccaaaactcaaatag

DBGET integrated database retrieval system