KEGG   Arabidopsis thaliana (thale cress): AT3G16980
Entry
AT3G16980         CDS       T00041                                 
Symbol
NRPB9A
Name
(RefSeq) RNA polymerases M/15 Kd subunit
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G16980 (NRPB9A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G16980 (NRPB9A)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G16980 (NRPB9A)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     AT3G16980 (NRPB9A)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT3G16980 (NRPB9A)
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD zinc_ribbon_4 DNA_RNApol_7kD
Other DBs
NCBI-GeneID: 820954
NCBI-ProteinID: NP_188323
TAIR: AT3G16980
UniProt: Q6NLH0 A0A178VJH2
Structure
Position
3:5794392..5795827
AA seq 114 aa
MSTMKFCRECNNILYPKEDKEQKILLYACRNCDHQEVADNSCVYRNEVHHSVSERTQILT
DVASDPTLPRTKAVRCSKCQHREAVFFQATARGEEGMTLFFVCCNPNCGHRWRE
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagtactatgaaattttgccgcgaatgtaataacattctgtatcctaaggaggacaaa
gaacagaagatcctcctctatgcttgccgtaattgtgatcaccaggaggtagctgataac
agctgtgtgtacagaaacgaggttcatcactctgtaagtgagcgaactcagatcttaaca
gacgtggcttctgaccctactcttccccgaaccaaggctgtgcgttgctctaagtgtcag
catagggaggccgttttcttccaggctacggctagaggtgaagaaggaatgacactgttc
tttgtctgttgcaacccgaattgtggtcatcgctggagagaataa

KEGG   Arabidopsis thaliana (thale cress): AT4G16265
Entry
AT4G16265         CDS       T00041                                 
Symbol
NRPB9B
Name
(RefSeq) RNA polymerases M/15 Kd subunit
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G16265 (NRPB9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G16265 (NRPB9B)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G16265 (NRPB9B)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     AT4G16265 (NRPB9B)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT4G16265 (NRPB9B)
SSDB
Motif
Pfam: RNA_POL_M_15KD TFIIS_C zinc_ribbon_4
Other DBs
NCBI-GeneID: 827321
NCBI-ProteinID: NP_567490
TAIR: AT4G16265
UniProt: Q8L5V0 A0A178URI7
Position
4:complement(9202250..9204147)
AA seq 114 aa
MSTMKFCRECNNILYPKEDKEQSILLYACRNCDHQEAADNNCVYRNEVHHSVSEQTQILS
DVASDPTLPRTKAVRCAKCQHGEAVFFQATARGEEGMTLFFVCCNPNCSHRWRE
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagtactatgaaattttgtcgcgaatgtaataacattctatatcccaaggaagacaag
gagcaatcaatcctcctctatgcgtgccgtaattgtgatcaccaggaagcagcagataac
aattgtgtttacagaaacgaggttcatcactctgtaagtgaacaaactcagatcctatct
gacgttgcttccgacccaactcttccacgtaccaaggctgtgcgatgcgccaagtgtcaa
cacggtgaagctgtcttcttccaggccacggctagaggcgaagaaggaatgactctgttt
ttcgtttgctgcaacccgaactgtagtcaccgttggagagaatag

DBGET integrated database retrieval system