KEGG   Arabidopsis thaliana (thale cress): AT3G17810
Entry
AT3G17810         CDS       T00041                                 
Symbol
PYD1
Name
(RefSeq) pyrimidine 1
  KO
K00207  dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00240  Pyrimidine metabolism
ath00410  beta-Alanine metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
Module
ath_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT3G17810 (PYD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G17810 (PYD1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G17810 (PYD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.2  dihydropyrimidine dehydrogenase (NADP+)
     AT3G17810 (PYD1)
SSDB
Motif
Pfam: DHO_dh Dus
Other DBs
NCBI-GeneID: 821049
NCBI-ProteinID: NP_188408
TAIR: AT3G17810
UniProt: Q9LVI9 A0A178VD08
Position
3:6093990..6096688
AA seq 426 aa
MASMSFALNRFSGLSSKTTLSADFDPSSRRSFLPPTRVGLKISSAAESEPDLSVTVNGLK
MPNPFVIGSGPPGTNYTVMKRAFDEGWGAVIAKTVSLDASKVINVTPRYARLRTGSNGSA
KTDVIGWQNIELISDRPLETMLKEFERLKKEYPDRILIASVMEEYNKTAWEELIDRVEQT
GVDALEINFSCPHGMPERRMGAAVGQDCALLDEVCGWINAKATVPVWAKMTPNITDITEP
ARVSLKSGCEGIAAINTIMSVMGIDMKTLRPEPCVEGYSTPGGYSYKAVRPIALAKVMNI
AKMMKSEFSEDRSLSGIGGVETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTLCAELKD
FMKQHNFSTIEEFRGHSLQYFTTHTDLVKRQKEAVEQRKAEKRGLKSDKDWTGDGFVKET
ESMVSN
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcttccatgagtttcgccttgaatcgcttctctggactctcctctaaaaccacctta
tcagctgacttcgatccatcctctcgccggagttttctaccgccgactagagttggactt
aagatctcttccgccgccgaatcggagcctgatctcagtgtcactgtaaatggcctgaaa
atgcccaatcctttcgtgatcgggtcgggtccaccgggtaccaactacaccgtcatgaag
agagcctttgatgaaggttggggggccgtcatcgccaaaaccgtatctttagatgcatcc
aaagttatcaacgtgacacctagatatgctcggctacgaaccggatccaatggctcagcc
aaaacagatgtaattgggtggcagaacatagaactcatcagtgacagacctcttgaaacc
atgctcaaagagtttgagcggttgaaaaaagagtatcctgatcggattctgattgcttca
gtcatggaggaatataacaaaactgcttgggaagagcttatcgaccgtgttgagcaaact
ggtgttgatgctttagaaatcaacttctcgtgtcctcatggtatgccagagcgcagaatg
ggtgccgctgttggacaagattgtgcgcttctcgacgaggtttgcggatggattaatgct
aaagctacagttcctgtatgggctaagatgactcctaatattactgacataactgagcct
gctagggtgtcactaaaatccggatgtgaaggaattgcagcgatcaatacaatcatgagt
gtaatgggaattgatatgaagacgttgcgtcctgagccatgcgttgaaggttactccact
ccagggggatactcttataaggccgttcgcccaattgcactggcaaaagttatgaacatt
gccaaaatgatgaaatctgagtttagtgaggatcgctcgctttcgggtattggaggagtt
gaaactggctatgatgccgctgaattcattctccttggatcaaatactgtacaggtatgc
accggtgtgatgatgcacggctatggtcatgtgaaaaccctttgcgctgagctgaaagat
ttcatgaaacaacacaacttctctacaatagaagagttcagagggcattcgctgcagtac
tttacaacacacacagatttagttaagagacagaaagaagcagttgagcagagaaaagct
gagaagagaggcttgaaatctgataaagattggaccggggatgggttcgtgaaggagact
gagagtatggtttctaactaa

DBGET integrated database retrieval system