KEGG   Arabidopsis thaliana (thale cress): AT3G18090
Entry
AT3G18090         CDS       T00041                                 
Symbol
NRPD2B
Name
(RefSeq) nuclear RNA polymerase D2B
  KO
K16252  DNA-directed RNA polymerase IV and V subunit 2 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G18090 (NRPD2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G18090 (NRPD2B)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT3G18090 (NRPD2B)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     AT3G18090 (NRPD2B)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_7 RNA_pol_Rpb2_1 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_2 RNA_pol_Rpb2_5 CFAP77 DUF2002
Other DBs
NCBI-GeneID: 821334
NCBI-ProteinID: NP_188437
TAIR: AT3G18090
UniProt: Q9LV32
Position
3:6194509..6200424
AA seq 1055 aa
MACRLQNMTYSARIKVNAQVEVFKKIVIKHDKFKTGQDEYVEKEILDVKKQDILIGSIPV
MVKSVLCKTSEKGKENCKKGNCAFDQGGYFVIKGAEKVFIAQEQMCTKRLWISNSPWTVS
FRSETKRNRFIVRLSENEKAEDYKIMEKVLTVYFLSTEIPVWLLFFALGVSSDKEAMDLI
AFDGDDASITNSLIASIHEADAVCEAFRCGNNALTYVEHQIKSTKFPPAESVDDCLRLYL
FPCLQGLKKKARFLGYMVKCLLSAYAGKRKCENRDSFRNKRIELAGELLEREIRVHLAHA
RRKMTRAMQKQLSGDGDLKPIEHYLDASVITNGLNRAFSTGAWSHPFRKMERVSGVVANL
GRANPLQTLIDLRRTRQQVLYTGKVGDARHPHPSHWGRVCFLSTPDGENCGLVKNMSLLG
LVSTQGLESVVEMLFTCGMEELMNDTSTPLCGKHKVLLNGDWVGLCADSESFVGELKSRR
RQSELPLEMEIKRDKDDNEVRIFTDAGRLLRPLLVVENLHKLKQDKPTQYPFKHLLDQGI
LELIGIEEEEDCTTAWGIKQLLKEPKNYTHCELDLSFLLGVSCAIVPFANHDHGKRVLYQ
SQKHCQQAIGFSSTNPNIRCDTLSQQLFYPQKPLFKTLASECLEKEVLFNGQNAIVAVNV
HLGYNQEDSIVMNKASLERGMFRSEQIRSYKAEVDTKDSEKRKKMDELVQFGKTYSKIGK
VDSLEDDGFPFIGANMSTGDIVIGRCTESGADHSIKLKHTERGIVQKVVLSSNDEGKNFA
AVSLRQVRSPCLGDKFSSMHGQKGVLGYLEEQQNFPFTIQGIVPDIVINPHAFPSRQTPG
QLLEAALSKGIACPIQKKEGSSAAYTKLTRHATPFSTPGVTEITEQLHRAGFSRWGNERV
YNGRSGEMMRSLIFMGPTFYQRLVHMSENKVKFRNTGPVHPLTRQPVADRKRFGGIRFGE
MERDCLIAHGASANLHERLFTLSDSSQMHICRKCKTYANVIERTPSSGRKIRGPYCRVCA
SSDHVVRVYVPYGAKLLCQELFSMGITLNFDTKLC
NT seq 3168 nt   +upstreamnt  +downstreamnt
atggcatgcaggcttcagaacatgacatactcagcaaggatcaaagtcaatgcccaagtt
gaggtgttcaaaaaaattgttattaaacacgacaaattcaagactggacaagatgaatat
gtcgagaaggagatactggatgtcaaaaaacaggacattctaattggtagcatacctgtc
atggtgaaatctgtcctttgcaaaactagcgagaaaggaaaagaaaactgcaaaaagggg
aattgtgcctttgatcagggtggatattttgtgataaagggggctgagaaggtgtttata
gctcaagaacagatgtgcacaaagagattgtggatttctaattcaccatggacagtctcc
ttcaggtccgaaactaaaagaaataggttcattgtgcgcctctcggagaatgagaaagca
gaagactataagataatggagaaagtactgacagtgtacttcttgtcgactgagattcca
gtctggctcctgttctttgcgttgggtgtttcatcagacaaagaagccatggatctaatt
gctttcgatggtgatgatgcaagcattaccaacagtctcatagcttctatccatgaagct
gatgcagtgtgtgaagcttttcgctgtgggaacaatgccctaacatatgttgaacatcag
atcaaaagcaccaaattccctcctgctgaaagtgtggatgattgcctccgtctgtatttg
tttccatgcctccaaggtttgaagaagaaagcccgattcctgggctatatggtgaagtgc
cttttgagcgcgtatgcgggaaaacgaaaatgtgaaaacagggacagtttccggaataaa
cgaattgagctcgctggagaactgttggagagggagataagggtgcatcttgcacatgct
agaagaaagatgaccagggccatgcagaaacaactctcaggcgatggcgatttgaagcct
atagagcattatttggatgcttccgttatcaccaatgggcttaatagagccttctccact
ggagcatggtctcatcctttcaggaagatggaaagggtctcaggtgttgtagctaatttg
ggtcgtgcaaatccattgcagactctgattgatctgaggagaacgcgacagcaagtcctt
tataccggcaaggttggagatgctagacatccgcatccttctcactggggcagagtatgc
tttttgtcaactccagatggtgaaaattgtggtcttgtgaagaacatgtctcttcttgga
cttgttagcactcaaggtttggagtctgtggtggaaatgctctttacttgcggaatggaa
gagctgatgaatgataccagcacaccattgtgtggcaaacacaaagttcttctcaatgga
gactgggttggattatgtgcagattctgaatcctttgtcggggagttaaaaagcaggcgg
cgccaaagtgaattacctctcgagatggaaatcaagcgagataaagatgacaatgaggtg
agaattttcactgacgctggtagactactccgacctctcttggttgtggaaaatctccac
aagttgaagcaagacaaacctacacagtatccttttaagcatcttcttgaccaagggatt
ctcgagctgatcgggattgaggaagaagaagactgtactacagcatggggaatcaaacag
cttctgaaggaaccaaagaattacacgcattgcgaattggacctatcattcctgttgggt
gtgagctgtgcaattgtcccatttgcaaatcacgatcatgggaaaagagttctttaccag
tctcagaagcattgccaacaagccatcggattctcatcaacgaaccctaacatccgctgc
gatacgctgtcccagcagctgttctatccccaaaagccacttttcaagacattggcgtca
gagtgtcttgaaaaagaagttctatttaatggccagaacgcaattgttgctgtgaatgtt
catctcgggtacaaccaagaggactccattgtgatgaacaaggcttcattggaacgtggt
atgttccgttcagagcagattagaagctacaaagcagaggttgatactaaagactcggag
aagaggaagaagatggatgagcttgttcagtttggaaagacatacagcaaaatcggcaaa
gtagacagccttgaagatgacgggtttcctttcattggtgctaacatgagtactggcgat
attgtcattggcagatgcaccgagtctggggctgatcacagtataaagctcaagcacact
gagagaggaattgtgcaaaaagtggtattatcttctaatgatgaagggaagaattttgca
gcggtttctctgagacaggttcgttctccatgccttggagataagttttccagtatgcat
ggccagaagggtgttttaggctatctagaggaacagcagaattttcctttcacgatccaa
ggcatagttcctgatattgtgataaacccgcacgctttcccttctaggcagacaccaggt
caactcttggaggctgctctctccaaaggaatcgcttgtcctatacaaaagaaggagggt
agctctgctgcatacaccaaattgacacgtcatgccactcctttctccactccgggtgtc
actgaaatcaccgagcagcttcacagggccggcttttcaagatggggaaacgaaagggtc
tacaatggtagatcgggtgagatgatgcgctctctgatattcatgggcccaactttctac
cagcgacttgtccacatgtcagagaacaaagtcaagttcaggaacaccggaccagtccac
ccgctcacacgccagccagtcgcagaccggaagaggtttggcgggataagatttggagaa
atggagcgagactgcctaatagctcacggtgcatccgctaatctgcacgagcggctcttc
actctaagtgactcttctcagatgcacatctgcagaaaatgcaagacctatgcgaatgtg
atcgagaggactccaagcagtggaagaaagatcagagggccatattgcagagtgtgcgca
tcctccgaccatgtggttagggtctatgttccttatggagctaagcttctttgtcaggag
ctgttcagcatgggcattactctcaacttcgacaccaagctctgctga

KEGG   Arabidopsis thaliana (thale cress): AT3G23780
Entry
AT3G23780         CDS       T00041                                 
Symbol
NRPD2A
Name
(RefSeq) nuclear RNA polymerase D2A
  KO
K16252  DNA-directed RNA polymerase IV and V subunit 2 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G23780 (NRPD2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G23780 (NRPD2A)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT3G23780 (NRPD2A)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     AT3G23780 (NRPD2A)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_2 RNA_pol_Rpb2_5 CFAP77 DUF2002
Other DBs
NCBI-GeneID: 821960
NCBI-ProteinID: NP_001189957
TAIR: AT3G23780
UniProt: Q9LK40 A0A178VA17
Structure
Position
3:complement(8567572..8574209)
AA seq 1172 aa
MPDMDIDVKDLEEFEATTGEINLSELGEGFLQSFCKKAATSFFDKYGLISHQLNSYNYFI
EHGLQNVFQSFGEMLVEPSFDVVKKKDNDWRYATVKFGEVTVEKPTFFSDDKELEFLPWH
ARLQNMTYSARIKVNVQVEVFKNTVVKSDKFKTGQDNYVEKKILDVKKQDILIGSIPVMV
KSILCKTSEKGKENCKKGDCAFDQGGYFVIKGAEKVFIAQEQMCTKRLWISNSPWTVSFR
SENKRNRFIVRLSENEKAEDYKRREKVLTVYFLSTEIPVWLLFFALGVSSDKEAMDLIAF
DGDDASITNSLIASIHVADAVCEAFRCGNNALTYVEQQIKSTKFPPAESVDECLHLYLFP
GLQSLKKKARFLGYMVKCLLNSYAGKRKCENRDSFRNKRIELAGELLEREIRVHLAHARR
KMTRAMQKHLSGDGDLKPIEHYLDASVITNGLSRAFSTGAWSHPFRKMERVSGVVANLGR
ANPLQTLIDLRRTRQQVLYTGKVGDARYPHPSHWGRVCFLSTPDGENCGLVKNMSLLGLV
STQSLESVVEKLFACGMEELMDDTCTPLFGKHKVLLNGDWVGLCADSESFVAELKSRRRQ
SELPREMEIKRDKDDNEVRIFTDAGRLLRPLLVVENLQKLKQEKPSQYPFDHLLDHGILE
LIGIEEEEDCNTAWGIKQLLKEPKIYTHCELDLSFLLGVSCAVVPFANHDHGRRVLYQSQ
KHCQQAIGFSSTNPNIRCDTLSQQLFYPQKPLFKTLASECLKKEVLFNGQNAIVAVNVHL
GYNQEDSIVMNKASLERGMFRSEQIRSYKAEVDAKDSEKRKKMDELVQFGKTHSKIGKVD
SLEDDGFPFIGANMSTGDIVIGRCTESGADHSIKLKHTERGIVQKVVLSSNDEGKNFAAV
SLRQVRSPCLGDKFSSMHGQKGVLGYLEEQQNFPFTIQGIVPDIVINPHAFPSRQTPGQL
LEAALSKGIACPIQKEGSSAAYTKLTRHATPFSTPGVTEITEQLHRAGFSRWGNERVYNG
RSGEMMRSMIFMGPTFYQRLVHMSEDKVKFRNTGPVHPLTRQPVADRKRFGGIKFGEMER
DCLIAHGASANLHERLFTLSDSSQMHICRKCKTYANVIERTPSSGRKIRGPYCRVCVSSD
HVVRVYVPYGAKLLCQELFSMGITLNFDTKLC
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgccagatatggacattgatgtgaaggatcttgaagagttcgaggctactactggggag
atcaatctatctgagctaggagaaggttttctgcagagtttctgcaaaaaagctgcaact
tctttctttgataagtatggacttataagtcatcagctcaactcctacaactacttcatt
gaacacgggcttcagaatgtgtttcaatcctttggtgagatgcttgtggaaccgtctttt
gatgttgtaaagaagaaggataatgattggagatacgcaacggtgaagttcggagaagtc
actgtggagaagcctactttcttttcggatgacaaggagcttgagtttctcccatggcat
gctaggcttcagaacatgacatactctgcaaggatcaaagtcaatgtccaagttgaggtg
ttcaagaatactgttgttaaaagcgacaaattcaagacaggacaagacaactatgtcgag
aagaagatactggatgtcaaaaagcaggacattctaattggtagcattcctgtcatggtg
aaatctatcctttgcaaaacaagcgagaaagggaaagaaaactgcaaaaagggggattgt
gcctttgatcagggtggatatttcgtgataaagggggctgagaaggtgtttatagctcaa
gaacagatgtgcacaaagagactgtggatttctaattcaccatggacagtctccttcagg
tccgaaaataaaagaaatagattcattgtgcgcctctcggagaatgagaaagcagaagac
tataagagaagggagaaagtactgacagtgtacttcttgtcgactgagattccagtctgg
ctcctcttctttgcgctaggtgtttcgtcagacaaagaagccatggatctaattgctttt
gatggtgatgatgcaagcattaccaacagtctcatagcttctatccatgtagctgatgca
gtttgtgaagcttttcgctgtgggaacaatgctttaacatatgttgaacagcagatcaaa
agcaccaaattccctcctgctgaaagtgtggatgagtgcctccatctgtatttgtttcca
ggcctccaaagtttgaagaagaaagctcgattcctgggctatatggtgaagtgccttctg
aactcgtatgcgggaaaaagaaaatgcgaaaacagggacagtttccggaataagcgaatt
gagctcgctggagaactattggagagggagataagggtgcatctggcacatgctagaaga
aagatgaccagggccatgcagaaacacctctcaggcgatggtgatttgaagcctattgag
cattatttggatgcttctgttatcacaaatgggcttagtagagccttctctactggagca
tggtctcatcctttcaggaagatggaaagggtttcaggtgttgtggctaatttgggtcgt
gcaaatccattgcagactctgattgatctgaggagaacgcgacagcaagtcttatatacc
ggcaaggttggagatgctagatatccgcacccctctcactggggcagagtatgctttttg
tcaactccagacggtgaaaattgtggtcttgtgaagaacatgtctcttctgggacttgtg
agcacccaaagtttggagtctgtggtggaaaagctcttcgcttgtggaatggaagagctg
atggatgatacatgcacaccattgtttggcaaacataaagttcttctcaatggagactgg
gttggattatgtgcagattctgaatcctttgtcgcggagttaaaaagcaggcggcgccaa
agtgaattacctcgtgagatggaaatcaagcgagataaagatgacaatgaggtaagaatt
ttcactgatgctggtagactactccgacctctcttggttgtggaaaatctccaaaagttg
aagcaagaaaaaccttcacagtatccttttgaccatcttcttgaccatgggattctcgag
ctgatcgggattgaggaagaagaagactgtaatacagcatggggaatcaaacagcttctg
aaggaaccaaagatatacacacattgcgaattggacctgtcattcttgttgggtgtgagc
tgtgcagttgtcccatttgcaaatcacgaccatgggagaagagttctctaccagtcccag
aagcactgccaacaagccattggattctcatcaacgaaccctaacatccgctgcgatacg
ctgtcccagcagctgttctatcctcagaagccactgttcaagacattggcgtcggagtgt
cttaaaaaagaagtgctgttcaatggccagaacgcaattgttgctgtgaatgttcatctc
gggtacaaccaagaggattccattgtgatgaacaaggcttcattggaacgtggtatgttc
cgttcagagcagattagaagctacaaagcagaggttgatgctaaagactcagagaagagg
aagaagatggatgagcttgttcagtttggaaagacacacagcaaaatcggcaaagtagac
agccttgaagatgacgggtttcctttcattggtgctaacatgagtactggcgatattgtc
attggcagatgcaccgagtctggggctgatcacagtataaagctcaagcacactgagaga
ggaattgtgcaaaaagtggtattatcatctaatgatgaagggaagaattttgctgcggtt
tctctgagacaggttcgttctccatgccttggagataagttttccagtatgcatggccag
aagggtgttttaggctacctagaggaacagcagaattttcctttcacgatccaaggcata
gttcctgatattgtgataaacccgcacgctttcccttctaggcaaacaccaggtcaactc
ttggaggctgctctctccaaaggaatcgcttgtcctatacaaaaggagggtagctctgct
gcatacaccaaattgacacgtcatgccactcctttctccactccgggtgtcactgaaatc
accgagcagcttcacagggccggcttttcaagatggggaaacgaaagggtctacaacggt
agatcaggtgagatgatgcgttctatgatattcatgggcccaactttctaccagcgactt
gtccacatgtcagaggacaaagtcaagttcaggaacactggaccagtccacccgctcaca
cgccagccagttgcagacaggaagagatttggcgggataaaatttggagaaatggagcga
gactgcctaatagctcacggtgcatcagctaatctgcatgagcgtctcttcactctaagt
gactcttctcagatgcacatctgcagaaaatgtaagacctatgcgaatgtgatcgagagg
actccaagcagtggaagaaagattagagggccatattgtagagtctgcgtatcctcagac
catgtggttagggtctatgttccgtatggagctaagcttctgtgtcaggagctgttcagc
atgggcatcactctcaacttcgacaccaagctatgctga

DBGET integrated database retrieval system