KEGG   Arabidopsis thaliana (thale cress): AT3G18524
Entry
AT3G18524         CDS       T00041                                 
Symbol
MSH2
Name
(RefSeq) MUTS homolog 2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT3G18524 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G18524 (MSH2)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AT3G18524 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_IV MutS_I MutS_II ATG17_like
Other DBs
NCBI-GeneID: 821383
NCBI-ProteinID: NP_566804
TAIR: AT3G18524
UniProt: O24617 A0A654F8E8
Position
3:complement(6367941..6372685)
AA seq 937 aa
MEGNFEEQNKLPELKLDAKQAQGFLSFYKTLPNDTRAVRFFDRKDYYTAHGENSVFIAKT
YYHTTTALRQLGSGSNALSSVSISRNMFETIARDLLLERNDHTVELYEGSGSNWRLVKTG
SPGNIGSFEDVLFANNEMQDTPVVVSIFPSFHDGRCVIGMAYVDLTRRVLGLAEFLDDSR
FTNLESSLIALGAKECIFPAESGKSNECKSLYDSLERCAVMITERKKHEFKGRDLDSDLK
RLVKGNIEPVRDLVSGFDLATPALGALLSFSELLSNEDNYGNFTIRRYDIGGFMRLDSAA
MRALNVMESKTDANKNFSLFGLMNRTCTAGMGKRLLHMWLKQPLVDLNEIKTRLDIVQCF
VEEAGLRQDLRQHLKRISDVERLLRSLERRRGGLQHIIKLYQSTIRLPFIKTAMQQYTGE
FASLISERYLKKLEALSDQDHLGKFIDLVECSVDLDQLENGEYMISSSYDTKLASLKDQK
ELLEQQIHELHKKTAIELDLQVDKALKLDKAAQFGHVFRITKKEEPKIRKKLTTQFIVLE
TRKDGVKFTNTKLKKLGDQYQSVVDDYRSCQKELVDRVVETVTSFSEVFEDLAGLLSEMD
VLLSFADLAASCPTPYCRPEITSSDAGDIVLEGSRHPCVEAQDWVNFIPNDCRLMRGKSW
FQIVTGPNMGGKSTFIRQVGVIVLMAQVGSFVPCDKASISIRDCIFARVGAGDCQLRGVS
TFMQEMLETASILKGASDKSLIIIDELGRGTSTYDGFGLAWAICEHLVQVKRAPTLFATH
FHELTALAQANSEVSGNTVGVANFHVSAHIDTESRKLTMLYKVEPGACDQSFGIHVAEFA
NFPESVVALAREKAAELEDFSPSSMIINNEESGKRKSREDDPDEVSRGAERAHKFLKEFA
AIPLDKMELKDSLQRVREMKDELEKDAADCHWLRQFL
NT seq 2814 nt   +upstreamnt  +downstreamnt
atggagggtaatttcgaggaacagaacaagcttccggagctgaaattggatgcaaagcaa
gctcaagggtttctctcgttctacaaaaccctaccaaatgatacgagagctgttagattc
tttgatcgcaaggattattatacagctcatggtgaaaattcagttttcattgcaaagact
tattatcatacaaccactgctctacgtcagctcgggagtggttcaaatgctctttcaagc
gtaagcattagtaggaacatgttcgaaacgattgctagggatcttctcctggagcgtaat
gatcatactgtagaactttatgagggaagcggatcgaattggagacttgtgaaaacaggt
tctcctggaaacattggaagctttgaagatgttttgtttgcaaacaatgaaatgcaggac
acaccagttgttgtctccatatttccaagttttcacgatggcagatgcgttattgggatg
gcctatgttgatctgactaggcgagttcttggactagctgagtttcttgatgatagccgc
ttcaccaatctggagtcttcgttgattgctctaggcgcaaaagaatgcatttttccagct
gaatccggcaaatccaatgaatgcaaaagcctgtatgattccctggagaggtgtgccgtg
atgataacagagaggaagaaacacgagttcaaaggaagagatttagattcagatcttaag
agattggtgaaggggaatattgagcctgttagagatttggtatccgggtttgaccttgcg
actcctgctctaggtgcattactctcgttttctgaacttctctcaaatgaggataactat
gggaacttcacaatccgcagatatgatattggcggattcatgagacttgactctgcagct
atgagggctttgaatgtgatggagagcaaaactgatgctaataagaatttcagtttgttt
ggtctcatgaacagaacatgtaccgcagggatgggtaagagactgcttcatatgtggctg
aagcaacccctcgtggatttgaatgagattaagacgagattagatatagttcagtgcttt
gttgaagaagctgggttaaggcaggatcttagacagcatctgaagcgaatctcagatgtt
gagaggcttttgcgcagtctcgagagaagaagaggtgggttacagcacattattaaactc
tatcagtcaactataaggcttcccttcatcaaaacagctatgcaacagtacaccggagaa
ttcgcatcactcatcagcgagagatacctgaaaaagcttgaggctttatcagatcaagat
caccttggaaagttcatcgatttggttgagtgctctgtagatcttgaccagctagaaaat
ggagaatacatgatatcttcaagctacgacaccaaattggcatctctgaaagatcagaaa
gaattgctggagcagcagattcacgaattgcacaaaaagacagcgatagaacttgatctt
caggtcgacaaggctcttaaacttgacaaagcagcgcaatttgggcatgtcttcaggatc
acgaagaaggaagagccaaagatcaggaagaagctgacgacacagtttatagtgctggag
actcgcaaagacggagtgaagttcacaaacacaaagctaaaaaaactgggggaccagtac
caaagtgttgtggatgattataggagctgtcaaaaggagctcgttgatcgtgtagttgag
actgttaccagcttctctgaggtatttgaggacttagctgggttactttctgaaatggat
gttttgttaagctttgctgatttggctgccagttgccctactccatactgtaggccagaa
atcacctcttcggatgctggagatattgtactagaaggaagcagacatccatgtgtagaa
gctcaagattgggtgaatttcataccaaatgattgcagactcatgagagggaagagttgg
tttcaaatagtaacagggcctaacatgggagggaagtccactttcatccgccaggttggt
gtgattgtgctgatggctcaagttggttcctttgttccttgtgataaagcatcaatttcc
ataagagactgcatctttgcccgtgtaggagcaggcgattgccaactgcgtggagtgtca
acttttatgcaagaaatgcttgaaaccgcatcgatattgaaaggcgctagtgataagtca
ctgataattatcgatgaacttggtcgtggaacatcaacttatgatggttttggtttagct
tgggctatatgtgagcatctggttcaagtgaaaagagcaccaactctgtttgctactcac
ttccatgaacttactgccttggctcaagcaaactctgaggtctctggtaacactgttggt
gtggcaaacttccatgtcagcgctcacattgacactgaaagccgcaaactcaccatgctt
tacaaggttgaaccaggggcctgtgaccagagctttgggattcatgtggcggaatttgcc
aacttccctgaaagcgtcgtggccctcgcaagagagaaagctgcagagctggaagatttc
tctccctcctccatgataatcaacaatgaggagagtgggaagagaaagagcagagaagat
gatccagatgaagtatcaagaggggcagagcgagctcacaagtttctgaaagagtttgca
gcgataccacttgataaaatggagcttaaagattcacttcaacgggttcgtgagatgaaa
gatgagctagagaaagatgctgcagactgccactggctcaggcagtttctgtga

DBGET integrated database retrieval system