KEGG   Arabidopsis thaliana (thale cress): AT3G18580
Entry
AT3G18580         CDS       T00041                                 
Name
(RefSeq) Nucleic acid-binding, OB-fold-like protein
  KO
K03111  single-strand DNA-binding protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03030  DNA replication
ath03430  Mismatch repair
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AT3G18580
   03430 Mismatch repair
    AT3G18580
   03440 Homologous recombination
    AT3G18580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ath03032]
    AT3G18580
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G18580
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G18580
DNA replication proteins [BR:ath03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AT3G18580
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AT3G18580
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AT3G18580
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    AT3G18580
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-GeneID: 821389
NCBI-ProteinID: NP_188488
TAIR: AT3G18580
UniProt: Q9LII1 A0A384L859
Position
3:complement(6396747..6398261)
AA seq 217 aa
MANSMATLSRRLYRSLLSNPRISQASMSFCTNNITSPEDSDFDELESPIEPKASDPVSRF
SGEERVMEERPLENGLDSGIFKAILVGQVGQLPLQKKLKSGRTVTLFSVGTGGIRNNRRP
LINEDPREYASRSAVQWHRVSVYPERLADLVLKNVEPGTVIYLEGNLETKIFTDPVTGLV
RRIREVAIRRNGRVVFLGKAGDMQQPSSAELRGVGYY
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgaattcaatggctacactttctagaagactctatcgatctcttctatcgaaccct
agaatttctcaagcttccatgtctttctgtaccaacaacatcacttccccagaagactcc
gactttgacgagttagaatcgcccattgaaccaaaggcctcagatccagtttctcgattt
tccggagaagaacgcgttatggaagagcgtccactcgaaaatggccttgactctggcatt
ttcaaggcaatattggtggggcaagtgggtcagcttcctctgcagaagaagcttaagagt
ggtagaactgtcactctcttctctgtaggaactggtgggatcaggaacaaccggagaccg
cttattaacgaagatccgagagagtatgcgagccggtctgcggtgcagtggcaccgtgtc
tctgtttaccctgaacgcttggcagatcttgtgttgaagaatgttgaacccggtactgtt
atctacttagagggtaatctggagacgaagatattcactgatcctgtcactggtttggtt
cgacgtataagagaagtagcaattcgtagaaacggccgagttgtgtttttgggaaaagcc
ggtgatatgcagcaaccgagttctgctgagcttagaggcgttggctactactga

DBGET integrated database retrieval system