KEGG   Arabidopsis thaliana (thale cress): AT3G22900
Entry
AT3G22900         CDS       T00041                                 
Symbol
NRPD7
Name
(RefSeq) RNA polymerase Rpb7-like, N-terminal domain-containing protein
  KO
K16253  DNA-directed RNA polymerase IV and V subunit 7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G22900 (NRPD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G22900 (NRPD7)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     AT3G22900 (NRPD7)
SSDB
Motif
Pfam: SHS2_Rpb7-N S1 RNA_pol_Rbc25
Other DBs
NCBI-GeneID: 821862
NCBI-ProteinID: NP_001326806
TAIR: AT3G22900
UniProt: Q8LE42 A0A5S9XF48
Position
3:8115065..8116253
AA seq 174 aa
MFIKVKLPWDVTIPAEDMDTGLMLQRAIVIRLLEAFSKEKATKDLGYLITPTILENIGEG
KIKEQTGEIQFPVVFNGICFKMFKGEIVHGVVHKVHKTGVFLKSGPYEIIYLSHMKMPGY
EFIPGENPFFMNQYMSRIQIGARVRFVVLDTEWREAEKDFMALASIDGDNLGPF
NT seq 525 nt   +upstreamnt  +downstreamnt
atgttcatcaaagtgaaattgccatgggatgttacgattccagctgaagatatggacact
ggccttatgcttcagagagctattgtcattcgtctactcgaagccttttctaaagagaaa
gcaacaaaagatcttggatacttgataacaccgacaattcttgagaacatcggtgagggt
aagatcaaggaacagaccggcgaaattcagtttcccgtagtttttaacggaatctgcttc
aagatgtttaaaggagagattgttcatggtgtggtgcacaaggttcacaagactggtgtc
tttttgaaatctggcccttatgaaatcatttacctatcacacatgaaaatgcctggttac
gagttcattccaggcgagaacccgtttttcatgaatcagtacatgtcccggattcaaatc
ggtgccagagttcgtttcgtcgtgttagataccgagtggagagaggcagagaaagacttc
atggctttggctagcatcgatggagacaatcttggtccgttctaa

KEGG   Arabidopsis thaliana (thale cress): AT4G14520
Entry
AT4G14520         CDS       T00041                                 
Name
(RefSeq) DNA-directed RNA polymerase II-like protein
  KO
K16253  DNA-directed RNA polymerase IV and V subunit 7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G14520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G14520
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     AT4G14520
SSDB
Other DBs
NCBI-GeneID: 827099
NCBI-ProteinID: NP_001328618
TAIR: AT4G14520
UniProt: Q6NML5 A0A178UWW9
Position
4:8341244..8343262
AA seq 200 aa
MFSEVEMARDVAICAKHLNGQSPHQPILCRLLQDLIHEKACREHGFYLGITALKSIGNNK
NNNIDNENNHQAKILTFPVSFTCRTFLPARGDILQGTVKKVLWNGAFIRSGPLRYAYLSL
LKMPHYHYVHSPLSEDEKPHFQKDDLSKIAVGVVVRFQVLAVRFKERPHKRRNDYYVLAT
LEGNGSFGPISLTGSDEPYM
NT seq 603 nt   +upstreamnt  +downstreamnt
atgttttcagaagtagaaatggctcgagacgtggctatatgtgccaaacacttgaatggc
caatcgccgcaccaaccgattctatgcagactactccaagatctaatacacgagaaagcg
tgcagggaacacggattctatctcggcatcaccgctctaaaaagcatcggtaacaacaag
aacaacaacatcgacaacgaaaacaatcatcaagcaaaaatcctcacattcccggtgtcc
ttcacatgccgcacattcttgcctgcaagaggagatatcttgcaagggactgtaaaaaaa
gtgttgtggaacggagcttttatcaggtcaggaccactcagatacgcatacctctcactc
ttgaaaatgccacattatcattatgtccactcaccattgtcggaggacgagaaaccgcat
tttcagaaagacgacctctcaaagattgctgttggagttgttgtgcggtttcaggtgttg
gctgtgcggtttaaagagagaccacacaagagaagaaacgactattatgttcttgcaact
ttggaaggcaatggttcatttggtcccatctctcttacagggtcagatgagccatacatg
taa

KEGG   Arabidopsis thaliana (thale cress): AT4G14660
Entry
AT4G14660         CDS       T00041                                 
Symbol
NRPE7
Name
(RefSeq) RNA polymerase Rpb7-like, N-terminal domain-containing protein
  KO
K16253  DNA-directed RNA polymerase IV and V subunit 7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G14660 (NRPE7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G14660 (NRPE7)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol IV and V specific subunits
     AT4G14660 (NRPE7)
SSDB
Motif
Pfam: SHS2_Rpb7-N S1 RNA_pol_Rbc25
Other DBs
NCBI-GeneID: 827116
NCBI-ProteinID: NP_001329853
TAIR: AT4G14660
UniProt: A6QRA1 A0A178V5D6
Position
4:complement(8406247..8407896)
AA seq 178 aa
MFLKVQLPWNVMIPAENMDAKGLMLKRAILVELLEAFASKKATKELGYYVAVTTLDKIGE
GKIREHTGEVLFPVMFSGMTFKIFKGEIIHGVVHKVLKHGVFMRCGPIENVYLSYTKMPD
YKYIPGENPIFMNEKTSRIQVETTVRVVVIGIKWMEVEREFQALASLEGDYLGPLSEE
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtttctcaaagtccaattaccatggaacgtgatgattccagctgaaaacatggatgcc
aaagggctgatgttgaagagagctatactagtagagttactagaggcgtttgcttccaag
aaagcaaccaaggagcttggctactacgtggcagtcacaactttggacaagattggagaa
ggcaaaatcagggagcacaccggtgaagttttgttcccggtaatgttcagcggaatgact
ttcaagatcttcaaaggagagataattcacggtgtggtgcacaaggtgttgaagcacggt
gtcttcatgaggtgtggtccaatcgagaatgtttacctctcctacacgaagatgccggat
tacaagtatatccctggagagaacccgatcttcatgaatgagaagacgtctaggattcag
gttgagactacagtgagggttgttgtgattgggataaagtggatggaagtagagagggag
tttcaggcgttggctagcttggaaggtgactatcttggaccattatctgaagagtga

DBGET integrated database retrieval system