KEGG   Arabidopsis thaliana (thale cress): AT3G24495
Entry
AT3G24495         CDS       T00041                                 
Symbol
MSH7
Name
(RefSeq) MUTS homolog 7
  KO
K08737  DNA mismatch repair protein MSH6
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT3G24495 (MSH7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G24495 (MSH7)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AT3G24495 (MSH7)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II AAA_29 RT_RNaseH_2 AAA_23
Other DBs
NCBI-GeneID: 822040
NCBI-ProteinID: NP_850630
TAIR: AT3G24495
UniProt: Q9SMV7
Position
3:complement(8912343..8918288)
AA seq 1109 aa
MQRQRSILSFFQKPTAATTKGLVSGDAASGGGGSGGPRFNVKEGDAKGDASVRFAVSKSV
DEVRGTDTPPEKVPRRVLPSGFKPAESAGDASSLFSNIMHKFVKVDDRDCSGERSREDVV
PLNDSSLCMKANDVIPQFRSNNGKTQERNHAFSFSGRAELRSVEDIGVDGDVPGPETPGM
RPRASRLKRVLEDEMTFKEDKVPVLDSNKRLKMLQDPVCGEKKEVNEGTKFEWLESSRIR
DANRRRPDDPLYDRKTLHIPPDVFKKMSASQKQYWSVKSEYMDIVLFFKVGKFYELYELD
AELGHKELDWKMTMSGVGKCRQVGISESGIDEAVQKLLARGYKVGRIEQLETSDQAKARG
ANTIIPRKLVQVLTPSTASEGNIGPDAVHLLAIKEIKMELQKCSTVYGFAFVDCAALRFW
VGSISDDASCAALGALLMQVSPKEVLYDSKGLSREAQKALRKYTLTGSTAVQLAPVPQVM
GDTDAAGVRNIIESNGYFKGSSESWNCAVDGLNECDVALSALGELINHLSRLKLEDVLKH
GDIFPYQVYRGCLRIDGQTMVNLEIFNNSCDGGPSGTLYKYLDNCVSPTGKRLLRNWICH
PLKDVESINKRLDVVEEFTANSESMQITGQYLHKLPDLERLLGRIKSSVRSSASVLPALL
GKKVLKQRVKAFGQIVKGFRSGIDLLLALQKESNMMSLLYKLCKLPILVGKSGLELFLSQ
FEAAIDSDFPNYQNQDVTDENAETLTILIELFIERATQWSEVIHTISCLDVLRSFAIAAS
LSAGSMARPVIFPESEATDQNQKTKGPILKIQGLWHPFAVAADGQLPVPNDILLGEARRS
SGSIHPRSLLLTGPNMGGKSTLLRATCLAVIFAQLGCYVPCESCEISLVDTIFTRLGASD
RIMTGESTFLVECTETASVLQNATQDSLVILDELGRGTSTFDGYAIAYSVFRHLVEKVQC
RMLFATHYHPLTKEFASHPRVTSKHMACAFKSRSDYQPRGCDQDLVFLYRLTEGACPESY
GLQVALMAGIPNQVVETASGAAQAMKRSIGENFKSSELRSEFSSLHEDWLKSLVGISRVA
HNNAPIGEDDYDTLFCLWHEIKSSYCVPK
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgcagcgccagagatcgattttgtctttcttccaaaaacccacggcggcgactacgaag
ggtttggtttccggcgatgctgctagcggcgggggcggcagcggaggaccacgatttaat
gtgaaggaaggggatgctaaaggcgacgcttctgtacgttttgctgtttcgaaatctgtc
gatgaggttagaggaacggatactccaccggagaaggttccgcgtcgtgtcctgccgtct
ggatttaagccggctgaatccgccggtgatgcttcgtccctgttctccaatattatgcat
aagtttgtaaaagtcgatgatcgagattgttctggagagaggagccgagaagatgttgtt
ccgctgaatgattcatctctatgtatgaaggctaatgatgttattcctcaatttcgttcc
aataatggtaaaactcaagaaagaaaccatgcttttagtttcagtgggagagctgaactt
agatcagtagaagatataggagtagatggcgatgttcctggtccagaaacaccagggatg
cgtccacgtgcttctcgcttgaagcgagttctggaggatgaaatgacttttaaggaggat
aaggttcctgtattggactctaacaaaaggctgaaaatgctccaggatccggtttgtgga
gagaagaaagaagtaaacgaaggaaccaaatttgaatggcttgagtcttctcgaatcagg
gatgccaatagaagacgtcctgatgatcccctttacgatagaaagaccttacacatacca
cctgatgttttcaagaaaatgtctgcatcacaaaagcaatattggagtgttaagagtgaa
tatatggacattgtgcttttctttaaagtggggaaattttatgagctgtatgagctagat
gcggaattaggtcacaaggagcttgactggaagatgaccatgagtggtgtgggaaaatgc
agacaggttggtatctctgaaagtgggatagatgaggcagtgcaaaagctattagctcgt
ggatataaagttggacgaatcgagcagctagaaacatctgaccaagcaaaagccagaggt
gctaatactataattccaaggaagctagttcaggtattaactccatcaacagcaagcgag
ggaaacatcgggcctgatgccgtccatcttcttgctataaaagagatcaaaatggagcta
caaaagtgttcaactgtgtatggatttgcttttgttgactgtgctgccttgaggttttgg
gttgggtccatcagcgatgatgcatcatgtgctgctcttggagcgttattgatgcaggtt
tctccaaaggaagtgttatatgacagtaaagggctatcaagagaagcacaaaaggctcta
aggaaatatacgttgacagggtctacggcggtacagttggctccagtaccacaagtaatg
ggggatacagatgctgctggagttagaaatataatagaatctaacggatactttaaaggt
tcttctgaatcatggaactgtgctgttgatggtctaaatgaatgtgatgttgcccttagt
gctcttggagagctaattaatcatctgtctaggctaaagctagaagatgtacttaagcat
ggggatatttttccataccaagtttacaggggttgtctcagaattgatggccagacgatg
gtaaatcttgagatatttaacaatagctgtgatggtggtccttcagggaccttgtacaaa
tatcttgataactgtgttagtccaactggtaagcgactcttaaggaattggatctgccat
ccactcaaagatgtagaaagcatcaataaacggcttgatgtagttgaagaattcacggca
aactcagaaagtatgcaaatcactggccagtatctccacaaacttccagacttagaaaga
ctgctcggacgcatcaagtctagcgttcgatcatcagcctctgtgttgcctgctcttctg
gggaaaaaagtgctgaaacaacgagttaaagcatttgggcaaattgtgaaagggttcaga
agtggaattgatctgttgttggctctacagaaggaatcaaatatgatgagtttgctttat
aaactctgtaaacttcctatattagtaggaaaaagcgggctagagttatttctttctcaa
ttcgaagcagccatagatagcgactttccaaattatcagaaccaagatgtgacagatgaa
aacgctgaaactctcacaatacttatcgaactttttatcgaaagagcaactcaatggtct
gaggtcattcacaccataagctgcctagatgtcctgagatcttttgcaatcgcagcaagt
ctctctgctggaagcatggccaggcctgttatttttcccgaatcagaagctacagatcag
aatcagaaaacaaaagggccaatacttaaaatccaaggactatggcatccatttgcagtt
gcagccgatggtcaattgcctgttccgaatgatatactccttggcgaggctagaagaagc
agtggcagcattcatcctcggtcattgttactgacgggaccaaacatgggcggaaaatca
actcttcttcgtgcaacatgtctggccgttatctttgcccaacttggctgctacgtgccg
tgtgagtcttgcgaaatctccctcgtggatactatcttcacaaggcttggcgcatctgat
agaatcatgacaggagagagtacctttttggtagaatgcactgagacagcgtcagttctt
cagaatgcaactcaggattcactagtaatccttgacgaactgggcagaggaactagtact
ttcgatggatacgccattgcatactcggtttttcgtcacctggtagagaaagttcaatgt
cggatgctctttgcaacacattaccaccctctcaccaaggaattcgcgtctcacccacgt
gtcacctcgaaacacatggcttgcgcattcaaatcaagatctgattatcaaccacgtggt
tgtgatcaagacctagtgttcttgtaccgtttaaccgagggagcttgtcctgagagctac
ggacttcaagtggcactcatggctggaataccaaaccaagtggttgaaacagcatcaggt
gctgctcaagccatgaagagatcaattggggaaaacttcaagtcaagtgagctaagatct
gagttctcaagtctgcatgaagactggctcaagtcattggtgggtatttctcgagtcgcc
cacaacaatgcccccattggcgaagatgactacgacactttgttttgcttatggcatgag
atcaaatcctcttactgtgttcccaaataa

KEGG   Arabidopsis thaliana (thale cress): AT4G02070
Entry
AT4G02070         CDS       T00041                                 
Symbol
MSH6
Name
(RefSeq) MUTS homolog 6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT4G02070 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G02070 (MSH6)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AT4G02070 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_IV MutS_II
Other DBs
NCBI-GeneID: 828147
NCBI-ProteinID: NP_192116
TAIR: AT4G02070
UniProt: O04716 A0A654FL40
Position
4:905865..913290
AA seq 1324 aa
MAPSRRQISGRSPLVNQQRQITSFFGKSASSSSSPSPSPSPSLSNKKTPKSNNPNPKSPS
PSPSPPKKTPKLNPNPSSNLPARSPSPGPDTPSPVQSKFKKPLLVIGQTPSPPQSVVITY
GDEVVGKQVRVYWPLDKKWYDGSVTFYDKGEGKHVVEYEDGEEESLDLGKEKTEWVVGEK
SGDRFNRLKRGASALRKVVTDSDDDVEMGNVEEDKSDGDDSSDEDWGKNVGKEVCESEED
DVELVDENEMDEEELVEEKDEETSKVNRVSKTDSRKRKTSEVTKSGGEKKSKTDTGTILK
GFKASVVEPAKKIGQADRVVKGLEDNVLDGDALARFGARDSEKFRFLGVDRRDAKRRRPT
DENYDPRTLYLPPDFVKKLTGGQRQWWEFKAKHMDKVVFFKMGKFYELFEMDAHVGAKEL
DIQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVK
REVCAVVTKGTLTDGEMLLTNPDASYLMALTEGGESLTNPTAEHNFGVCLVDVATQKIIL
GQFKDDQDCSALSCLLSEMRPVEIIKPAKVLSYATERTIVRQTRNPLVNNLVPLSEFWDS
EKTIYEVGIIYKRINCQPSSAYSSEGKILGDGSSFLPKMLSELATEDKNGSLALSALGGA
IYYLRQAFLDESLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYSGT
LYAQLNQCITASGKRLLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKSLSRLP
DMERLIARMFSSIEASGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACSSLRAILKH
DTSRRLLHLLTPGQSLPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYDCACKTVEE
FESSLKKHLKEQRKLLGDASINYVTVGKDEYLLEVPESLSGSVPHDYELCSSKKGVSRYW
TPTIKKLLKELSQAKSEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAFAS
DSYEGVRCRPVISGSTSDGVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASFIL
LTGPNMGGKSTLLRQVCLAVILAQIGADVPAETFEVSPVDKICVRMGAKDHIMAGQSTFL
TELSETAVMLTSATRNSLVVLDELGRGTATSDGQAIAESVLEHFIEKVQCRGFFSTHYHR
LSVDYQTNPKVSLCHMACQIGEGIGGVEEVTFLYRLTPGACPKSYGVNVARLAGLPDYVL
QRAVIKSQEFEALYGKNHRKTDHKLAAMIKQIISSVASDSDYSASKDSLCELHSMANTFL
RLTN
NT seq 3975 nt   +upstreamnt  +downstreamnt
atggctccgtctcgccgacagatcagcggaagatctccgttggtgaaccagcagcgtcaa
atcacctccttctttgggaaatctgcttcatcatcttcttctccgtctccatctccttca
ccatctctctccaataagaaaacccccaaatctaacaaccctaaccctaaatctccgtct
ccgtcaccatctccgcctaagaaaacccccaaattgaaccctaaccctagttctaatctt
cctgctcgtagtcctagccctggtcctgatactccttctcctgtacagtccaagtttaag
aagccccttctcgtcatcggacagacaccttcgcctcctcaatcggtggtaattacttac
ggtgacgaggtggtggggaagcaagttagggtttattggcctttggataaaaaatggtat
gatgggagcgtgacgttttatgataagggtgagggtaagcatgtggttgagtatgaagat
ggggaagaagagtctttggatttgggaaaggagaagactgagtgggtggttggggaaaaa
tcaggagataggtttaatcgattgaaacgaggcgcttcggctttgagaaaagttgtgacg
gatagtgatgatgatgtggagatgggtaatgtggaagaagataaaagtgacggtgatgat
tctagcgatgaggattggggaaagaatgttgggaaggaggtttgtgagagtgaagaagat
gatgtggagttggttgatgagaatgaaatggatgaagaagagttggtggaagagaaagat
gaagaaacttctaaagttaatagagtatccaaaactgactctagaaagcggaagactagt
gaagtaacgaaatcaggtggtgagaagaaaagcaagactgatacaggcactatcttgaaa
ggttttaaggcttctgttgtggagcctgcgaagaagattggacaagctgatagggtggtc
aagggtttggaagataacgtgttggatggggatgctcttgctagatttggtgctcgtgat
tctgagaaattccgctttttgggagtagaccgaagggatgctaaaaggagacgccctact
gatgagaattatgatccgaggacactctacctccctcctgattttgtgaaaaaattaact
ggaggccagagacaatggtgggagtttaaagcaaagcatatggacaaagttgtattcttc
aagatgggtaaattctatgagctttttgagatggatgcacatgtcggagctaaggaactg
gatatacaatacatgaagggagagcaacctcattgtggatttccggagaagaatttttct
gtaaacattgagaaattagttagaaagggctatcgggttttagttgtcgaacaaacagaa
acacctgatcagctggagcaacgccgaaaagagacaggttccaaggataaagttgtgaag
cgcgaagtatgtgcagttgttacaaaaggcacgctgacagatggggagatgctattaact
aatccggatgcatcttatctaatggccttgactgaaggaggagaaagtttaactaatcct
acagcagagcacaattttggtgtatgtttggttgatgttgcgacacagaagataatactg
ggccagtttaaggatgatcaagattgcagtgcattatcttgcctgctatctgagatgagg
ccggtggaaattattaaaccagctaaggtgttgagttatgcaacagagagaacaatagtt
agacaaaccagaaatcccttagtaaataatctcgttccactttctgaattttgggattcg
gagaagaccatatatgaagttggaattatctacaagcgaatcaattgtcaaccgtcttct
gcttattctagtgagggaaagattctaggtgatggttcaagctttcttccaaaaatgttg
tctgaattagcaactgaagataagaatggtagcctggcactctctgctcttggtggtgcc
atttactacctgcgacaagcattcttggatgagagtctgcttagatttgcaaagtttgaa
tccctgccttactgtgatttcagcaacgttaatgagaagcagcacatggttcttgatgct
gctgctcttgaaaaccttgagatatttgaaaacagtagaaatggaggctattcaggaacg
ctgtatgctcaactgaatcaatgtatcactgcatctgggaaacggttactgaaaacatgg
ctggcaagacctttatataatacggaactgatcaaggaacgacaagatgctgtagcaatt
ctgcggggtgaaaatcttccgtactcactggaattccggaagtcgttgtccagacttcca
gacatggaacggttgattgcacgtatgttttctagcattgaagctagtggaagaaatggc
gataaagtggtgctatatgaagatacagctaagaagcaggtacaggaattcatatcaact
ctacgtggttgtgaaacaatggcagaagcatgctcttctctccgtgctatcttgaagcat
gatacatccaggcggctgcttcatttactaactcctggtcaaagtcttccaaatatatca
tcctccataaagtatttcaaggatgcttttgactgggtagaagctcacaattctggacgt
gtaataccccatgaaggagcagatgaagagtatgattgtgcctgcaaaacagtagaagaa
tttgagtccagtttgaaaaaacatctgaaagagcaacggaaattactcggagatgcatca
ataaactatgttacagttggaaaagatgaatacctcttggaagttcctgaaagtttaagt
gggagtgttcctcatgattatgaattatgctcatcgaaaaagggtgtctctcgatattgg
actcctaccataaagaaattattaaaagagctatcacaagcaaaatctgaaaaagagtcg
gccctgaagagcatttcacagagattgattggacgtttctgcgagcatcaagaaaaatgg
agacaattggtttctgcaacagctgagctggacgtgttgatcagcctcgcttttgcaagt
gattcttatgaaggagtaagatgccgcccagtaatatctggttctacatctgatggtgtt
ccacacttgtctgccactggtctagggcatccagttctaaggggtgattcgttaggcaga
ggctcttttgtaccaaataatgtaaagataggtggtgctgagaaagccagtttcatcctc
ctcacaggccctaatatgggtggaaaatcaacccttcttcgccaagtttgcttggctgta
atcttggctcagattggagcagatgtcccagcagaaacctttgaggtttcgcctgttgac
aaaatttgtgtccggatgggtgcaaaagatcatatcatggcaggacaaagcacgttttta
acagaactttcagaaactgcggtaatgttgacatcagccacccgaaactcgctggtggtg
ctagatgagcttggacgaggaacagccacatcagatgggcaagccattgcggaatccgta
cttgagcacttcatagaaaaggtgcagtgtagaggattcttctctactcattatcatcgt
ctctctgtggattatcaaaccaatccaaaggtctcactttgccatatggcatgtcaaata
ggagaaggaatcggtggagtagaagaagttacatttctctatagattgactcctggtgca
tgtcctaaaagttatggagttaacgttgctcggttagctggtcttccagattacgtactc
cagagagccgtgataaaatcccaagaattcgaggctttgtacggtaaaaaccatagaaaa
accgatcataaattagcagcaatgataaagcagatcatcagcagtgttgcatcagattct
gattactcagcttcaaaggactcattgtgtgagctacactccatggccaatacatttctc
cggttaaccaactaa

DBGET integrated database retrieval system