KEGG   Arabidopsis thaliana (thale cress): AT3G25810
Entry
AT3G25810         CDS       T00041                                 

Name
(RefSeq) Terpenoid cyclases/Protein prenyltransferases superfamily protein
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00902  Monoterpenoid biosynthesis
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    AT3G25810
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     AT3G25810
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth Ca_bind_SSO6904 Bac_DnaA
Other DBs
NCBI-GeneID: 822173
NCBI-ProteinID: NP_189209
TAIR: AT3G25810
UniProt: Q9LRZ6
Position
3:join(9430805..9431014,9431396..9431675,9431776..9432160,9432271..9432489,9432852..9432990,9433083..9433334,9433533..9433844)
AA seq 598 aa
MATLCIGSAPIYQNACIHNFRLQRPRRFISKSMTKTMPDANPLDLRRRSGNYQPSSWDHS
YLLSIENKYVNEKEVITRHVLKKKVKKMLEEVETKSRLEKLELIDDLQKLGVSYHFEQEI
NNILTNFHLENGKNIWKCDKEEDLHATALEFRLLRQHGFGVSEDIFDVIIDKIESNTFKS
DNITSIITLYEASYLSTKSDTKLHKVIRPFATEQIRNFVDDESETYNIMLREMAIHALEI
PYHWRMRRLETRWYIDAYEKKHDMNLFLAEFAKIDFNIVQTAHQEDVKYVSCWWKETGLG
SQLHFVRDRIVENYFWTVGMIYEPQFGYIRRIVAIVAALITVIDDIYDIYGTPEELELFT
AMVQNWDINRLDELPEYMKLCFLTLFNEINAMGCDVLKCKNIDVIPYFKKSWADLCKAYL
VEAKWYKGGYKPSVEEYMQNAWISISAPTMLIHFYCAFSGQISVQILESLVQQQQDVVRC
SATVLRLANDLATSPDELARGDVLKSVQCYMHETGVSEEEARTHVQQMISHTWDEMNYEA
RTAARSSSLLSRRFVETAMNLARMSQCMYQHGDGHGCPDKAKIVDRVQTLLVDPIPLD
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggctactttgtgtataggttcagctcctatttaccaaaatgcatgtatccataatttt
cgtcttcaacgtcctcgtcgtttcatatccaaatccatgacaaaaacgatgccggatgct
aatcctcttgacctccgtcgacgctcgggcaactatcaaccttcttcatgggaccatagt
tatctcctctccatcgagaacaaatatgtgaatgaaaaagaagtgataactagacatgtg
ttgaagaaaaaggtgaagaagatgctagaggaagtagagacgaagagccgtctcgagaaa
ttagagctcatcgatgatttacaaaagcttggggtttcgtatcattttgagcaagaaata
aataacattttgacaaattttcatcttgaaaatggaaaaaatatttggaaatgtgacaag
gaagaagatttacatgcaaccgcactcgaattccgacttcttagacaacatggttttggt
gtctcagaagatatatttgatgtaatcatcgacaaaatcgaaagtaatacgttcaagagt
gacaatataacaagtatcatcactctatacgaagcatcgtatctctccacgaaatcggat
actaaattgcataaagtcatcaggccttttgcaacagaacaaataagaaatttcgttgat
gatgaaagtgaaacttacaacattatgttacgtgagatggcgatccatgcgttagaaata
ccgtaccattggagaatgagaaggctagagacgagatggtatatagatgcatacgagaag
aaacatgacatgaatctttttttggccgaattcgccaaaatcgatttcaatatcgtacaa
actgctcatcaagaagatgtcaaatacgtttcctgttggtggaaggaaacaggtttgggt
agtcaacttcactttgtaagagacagaattgttgagaattatttttggaccgttggaatg
atatatgaaccacaatttggatatatccgacggatcgtggctatagttgctgcacttatt
acagttattgatgacatctacgatatttatggtactcctgaagaacttgagctcttcact
gctatggttcaaaattgggatataaatcgtcttgatgagctccccgaatacatgaagttg
tgttttcttacattgtttaatgaaatcaatgccatgggatgtgatgttctcaaatgtaaa
aatattgacgtcattccttatttcaaaaaatcgtgggcagatttatgtaaagcatatcta
gttgaagcaaagtggtacaaaggaggatacaaaccaagcgtggaagaatacatgcaaaat
gcttggatttcaatttctgctccaacaatgttaatccacttttactgtgctttctctggc
caaatctcggttcaaattttggagtctttggtccaacaacaacaagacgtcgtccgatgc
tctgccactgtgctccgtctagctaatgaccttgcaacttcgccggatgaattggcgaga
ggagacgttctcaaatcggtccaatgttacatgcatgagaccggagtttcggaggaagag
gcacgcacacatgtgcagcagatgataagtcacacgtgggacgagatgaactatgaagca
agaacagcggcacgcagttcttcgttactttctcgacgttttgttgaaactgcaatgaac
ctggcacgtatgtcgcagtgcatgtaccaacatggcgatggtcatggatgtcccgacaaa
gccaagatcgttgatcgtgtccaaaccttgctcgttgacccaatcccattagattaa

DBGET integrated database retrieval system