KEGG   Arabidopsis thaliana (thale cress): AT3G25940
Entry
AT3G25940         CDS       T00041                                 
Name
(RefSeq) TFIIB zinc-binding protein
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G25940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G25940
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     AT3G25940
SSDB
Motif
Pfam: TFIIS_C DZR Zn_ribbon_recom DUF3797 Zn_Tnp_IS91 Baculo_IE-1 HypA Zn-ribbon_8 Pput2613-deam A2L_zn_ribbon Baculo_LEF5_C TerY_C zf-C4_Topoisom zinc_ribbon_9 RNA_POL_M_15KD C1_1 zf-RING_5 zf-C2HC5 Churchill zf-H2C2_2
Other DBs
NCBI-GeneID: 822191
NCBI-ProteinID: NP_566786
TAIR: AT3G25940
UniProt: A0A384L1F2 Q9LU97
Position
3:9494626..9496092
AA seq 119 aa
MEKSRESEFLFCNLCGTMLVLKSTKYAECPHCKTTRNAKDIIDKEIAYTVSAEDIRRELG
ISLFGEKTQAEAELPKIKKACEKCQHPELVYTTRQTRSADEGQTTYYTCPNCAHRFTEG
NT seq 360 nt   +upstreamnt  +downstreamnt
atggagaaatctagagaaagcgagttcttgttctgtaatttgtgtgggactatgcttgtc
ttgaaatcaaccaagtatgcagaatgtccacattgcaaaacaacacggaatgcaaaagat
atcatcgacaaggaaatagcttacacagtttctgctgaggatatcagaagagaactagga
atatcattgtttggtgaaaaaacgcaggcagaagctgagctaccaaagatcaaaaaggca
tgcgagaaatgccagcatcctgagcttgtatacacaaccagacagacgagatcagctgat
gaaggacagacaacatattacacttgccccaattgtgctcatagattcacagaaggttga

DBGET integrated database retrieval system