KEGG   Arabidopsis thaliana (thale cress): AT3G28956
Entry
AT3G28956         CDS       T00041                                 
Name
(RefSeq) RNA polymerase II, Rpb4, core protein
  KO
K25304  DNA-directed RNA polymerase III subunit RPC9
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G28956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G28956
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT3G28956
SSDB
Motif
Pfam: RNA_pol_Rpb4
Other DBs
NCBI-GeneID: 822534
NCBI-ProteinID: NP_001325903
TAIR: AT3G28956
UniProt: A0A1I9LMM6
Position
3:complement(10980401..10982757)
AA seq 117 aa
MKIMKANAGALTNFELLDFLNSRGASKDTTRVIAPIARSEYKVYDYLVETAASTQTRESV
NKSADKCKDFKLAKAEILNIINLWPSSIVELLPVCLLFLAYTLPFISLHLTSLLHGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaaaataatgaaggcaaatgcaggagcacttaccaatttcgagttgcttgacttctta
aactcaagaggtgcttcaaaagatactacaagagttattgctccaattgctagatcagaa
tacaaggtctatgattatttggtggagactgctgcttccactcaaacacgagagagcgtt
aacaaatccgcagacaagtgtaaagatttcaaactcgctaaagctgagattctcaatatc
atcaatctctggccttcttctatagtcgaactgttaccggtttgtttgttgtttctagct
tatacactaccatttatatcactgcatttaacttctcttcttcatggtttataa

DBGET integrated database retrieval system