KEGG   Arabidopsis thaliana (thale cress): AT3G49000
Entry
AT3G49000         CDS       T00041                                 
Name
(RefSeq) RNA polymerase III subunit RPC82 family protein
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G49000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G49000
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT3G49000
SSDB
Motif
Pfam: RNA_pol_Rpc82 HTH_9 TFIIE_alpha
Other DBs
NCBI-GeneID: 824061
NCBI-ProteinID: NP_566914
TAIR: AT3G49000
UniProt: Q8LPK6 A0A384KQ15
Position
3:18162560..18165986
AA seq 523 aa
MSMSEFGIVYAIHIITVQFGSVVSKVCECLLRKGPLSSRDISRLAESDINHNKVKDILYL
LIQHNCVQAFSIEPPDGSESKAIVQYIVLFNNILHRVRYNKFSRIVNEELDSKCGAVLDG
LLSNGRLTLGQFIERDRDSGNTIGSEAIRDSLQKLVAARFVERIPSPEPVLGNKEKEPAK
RRGAKAAKILKEPETLEEQVVEAATPVDAIRFPLIFEEDSNSSLADDNSNITEGKRKQRD
VDTSDSSSGVIWRPNFEEFIHRLRHKACVEIVKERRDEGCAIVLRAMLEVGRSQEKKVKT
DNSAPMSVGSIYEEVIKTEAGRTMLQERVEACLDQLSATSSYLPAFVNEVNDSYIVDYKS
IISVAQKDEIEAVVMRRYGKEAFRMFRYLSQEGRFVETDKIADAALTEKKDTPQFLLKMW
KDGYLHMQKLAVTAPGMYTPFLLWKVNKLIVTTQMLDEMYHASLNLSLRLAHELEAEKEL
LLLPLDKLEGPLKERLKKVKAKRLLLSSTMFKLDDAIMLFHDF
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgtctatgtctgagtttggcattgtctacgccatccatatcatcaccgtccaattcggc
tccgtcgtctcgaaagtttgtgaatgtcttctacgtaaaggacctctttcctcacgagac
atctctcgtttagctgaatcagatatcaaccataacaaagttaaagatattctctatctc
ttgattcagcacaattgtgttcaagctttctccattgaacctcctgatggttctgagagc
aaagctattgtacagtatattgtgttgtttaacaacattctgcatcgtgtgaggtataac
aagttttcgaggattgtaaacgaagaacttgactccaagtgcggtgcagttcttgatggt
ttacttagtaacggtaggcttaccttgggacagtttattgaaagagatagagattcagga
aatacgataggttctgaagcaatcagagattctcttcagaaattggttgctgcccgtttt
gttgagcgcattccttctcccgaacctgttcttggaaacaaagaaaaagagccggcaaag
agaagaggcgctaaagctgccaagattcttaaagaaccagaaaccttggaggaacaagtt
gttgaagcagcaactccagttgacgcaataaggtttccacttatattcgaagaagattcc
aattcatctttagcagatgacaatagcaacatcactgaggggaagcgtaaacaacgtgat
gtggacacatcagattcgagcagtggagtaatttggcgtcctaattttgaggagttcatc
caccgccttagacataaggcgtgtgtggagatagtgaaagagcgccgggatgaaggatgt
gccattgtcttgagggcaatgttagaagtaggaagatcgcaagagaagaaggtgaaaaca
gacaattcggctccaatgtcagttggttccatttatgaagaagttattaagacagaagca
ggtcgcactatgttacaagagcgagttgaagcatgccttgaccaattgagtgctacgtct
tcttatctaccagcatttgtgaacgaagtgaatgattcatacatagttgattataaatcc
attatcagcgtagcacagaaagatgagatagaggcagtagtgatgagaagatatgggaaa
gaagctttcagaatgttcagatacttatcacaggaagggcgttttgttgagaccgataag
attgctgatgccgcgctgactgaaaagaaagatacaccgcaattccttttaaagatgtgg
aaagacggatacttacatatgcagaaattggcggtcacagctccgggtatgtatacaccg
tttctgttgtggaaggtaaacaagttgattgtgacaactcaaatgttggatgagatgtac
catgcgtcccttaacttgagtcttaggttggcccatgagttagaagccgaaaaagagttg
ctgttgttgccattagataaactggaaggaccattaaaggagagactgaaaaaggtcaaa
gccaagaggctgttactctcttccactatgtttaaacttgatgatgccattatgcttttt
catgacttttaa

DBGET integrated database retrieval system