KEGG   Arabidopsis thaliana (thale cress): AT3G52090
Entry
AT3G52090         CDS       T00041                                 
Symbol
NRPB11
Name
(RefSeq) DNA-directed RNA polymerase, RBP11-like protein
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G52090 (NRPB11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G52090 (NRPB11)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G52090 (NRPB11)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     AT3G52090 (NRPB11)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT3G52090 (NRPB11)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L Tup_N VirK
Other DBs
NCBI-GeneID: 824372
NCBI-ProteinID: NP_190777
TAIR: AT3G52090
UniProt: Q38859 A0A178VE18
Structure
Position
3:complement(19317737..19319123)
AA seq 116 aa
MNAPERYERFVVPEGTKKVSYDRDTKIINAASFTVEREDHTIGNIVRMQLHRDENVLFAG
YQLPHPLKYKIIVRIHTTSQSSPMQAYNQAINDLDKELDYLKNQFEAEVAKFSNQF
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaatgctcccgaacgatatgagcgattcgtcgtccctgaaggcaccaagaaggtttct
tatgatagggatacgaagatcatcaatgctgcttccttcacggttgagagagaagaccat
acgattggaaacattgtccgcatgcaacttcatcgcgacgagaatgtcttgtttgctgga
taccaacttcctcatcctcttaagtacaaaatcatagtgaggattcacacaacaagccag
tcttccccaatgcaagcatacaaccaggccatcaatgacttggacaaggagctcgactac
ttgaagaaccagtttgaggcagaggtggccaagttttcgaatcagttttaa

DBGET integrated database retrieval system