KEGG   Arabidopsis thaliana (thale cress): AT3G57660
Entry
AT3G57660         CDS       T00041                                 
Symbol
NRPA1
Name
(RefSeq) nuclear RNA polymerase A1
  KO
K02999  DNA-directed RNA polymerase I subunit RPA1 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT3G57660 (NRPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT3G57660 (NRPA1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT3G57660 (NRPA1)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     AT3G57660 (NRPA1)
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_1 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 824935
NCBI-ProteinID: NP_191325
TAIR: AT3G57660
UniProt: Q9SVY0
Position
3:21353497..21363201
AA seq 1670 aa
MAHAQTTEVCLSFHRSLLFPMGASQVVESVRFSFMTEQDVRKHSFLKVTSPILHDNVGNP
FPGGLYDLKLGPKDDKQACNSCGQLKLACPGHCGHIELVFPIYHPLLFNLLFNFLQRACF
FCHHFMAKPEDVERAVSQLKLIIKGDIVSAKQLESNTPTKSKSSDESCESVVTTDSSEEC
EDSDVEDQRWTSLQFAEVTAVLKNFMRLSSKSCSRCKGINPKLEKPMFGWVRMRAMKDSD
VGANVIRGLKLKKSTSSVENPDGFDDSGIDALSEVEDGDKETREKSTEVAAEFEEHNSKR
DLLPSEVRNILKHLWQNEHEFCSFIGDLWQSGSEKIDYSMFFLESVLVPPTKFRPPTTGG
DSVMEHPQTVGLNKVIESNNILGNACTNKLDQSKVIFRWRNLQESVNVLFDSKTATVQSQ
RDSSGICQLLEKKEGLFRQKMMGKRVNHACRSVISPDPYIAVNDIGIPPCFALKLTYPER
VTPWNVEKLREAIINGPDIHPGATHYSDKSSTMKLPSTEKARRAIARKLLSSRGATTELG
KTCDINFEGKTVHRHMRDGDIVLVNRQPTLHKPSLMAHKVRVLKGEKTLRLHYANCSTYN
ADFDGDEMNVHFPQDEISRAEAYNIVNANNQYARPSNGEPLRALIQDHIVSSVLLTKRDT
FLDKDHFNQLLFSSGVTDMVLSTFSGRSGKKVMVSASDAELLTVTPAILKPVPLWTGKQV
ITAVLNQITKGHPPFTVEKATKLPVDFFKCRSREVKPNSGDLTKKKEIDESWKQNLNEDK
LHIRKNEFVCGVIDKAQFADYGLVHTVHELYGSNAAGNLLSVFSRLFTVFLQTHGFTCGV
DDLIILKDMDEERTKQLQECENVGERVLRKTFGIDVDVQIDPQDMRSRIERILYEDGESA
LASLDRSIVNYLNQCSSKGVMNDLLSDGLLKTPGRNCISLMTISGAKGSKVNFQQISSHL
GQQDLEGKRVPRMVSGKTLPCFHPWDWSPRAGGFISDRFLSGLRPQEYYFHCMAGREGLV
DTAVKTSRSGYLQRCLMKNLESLKVNYDCTVRDADGSIIQFQYGEDGVDVHRSSFIEKFK
ELTINQDMVLQKCSEDMLSGASSYISDLPISLKKGAEKFVEAMPMNERIASKFVRQEELL
KLVKSKFFASLAQPGEPVGVLAAQSVGEPSTQMTLNTFHLAGRGEMNVTLGIPRLQEILM
TAAANIKTPIMTCPLLKGKTKEDANDITDRLRKITVADIIKSMELSVVPYTVYENEVCSI
HKLKINLYKPEHYPKHTDITEEDWEETMRAVFLRKLEDAIETHMKMLHRIRGIHNDVTGP
IAGNETDNDDSVSGKQNEDDGDDDGEGTEVDDLGSDAQKQKKQETDEMDYEENSEDETNE
PSSISGVEDPEMDSENEDTEVSKEDTPEPQEESMEPQKEVKGVKNVKEQSKKKRRKFVRA
KSDRHIFVKGEGEKFEVHFKFATDDPHILLAQIAQQTAQKVYIQNSGKIERCTVANCGDP
QVIYHGDNPKERREISNDEKKASPALHASGVDFPALWEFQDKLDVRYLYSNSIHDMLNIF
GVEAARETIIREINHVFKSYGISVSIRHLNLIADYMTFSGGYRPMSRMGGIAESTSPFCR
MTFETATKFIVQAATYGEKDTLETPSARICLGLPALSGTGCFDLMQRVEL
NT seq 5013 nt   +upstreamnt  +downstreamnt
atggctcacgctcaaaccacagaggtgtgtttgagttttcaccgctctttattgtttccc
atgggagcttcccaggtggtcgaatctgttagattcagtttcatgacagagcaagatgtt
cgaaagcatagtttcctgaaagttaccagtcctattttacacgataacgtgggcaatcct
tttcctggtggtctctatgatcttaaattaggtcctaaagatgataagcaagcttgcaat
tcatgtggtcagctcaaacttgcttgtccaggacattgtggtcatatcgagcttgtcttt
cctatttaccatcctttgctcttcaatcttcttttcaatttcttgcagagggcctgtttc
ttctgtcatcactttatggcaaaaccggaagatgttgaaagagctgtttctcagctgaaa
ctcatcattaaaggtgatatagtttccgcgaagcaattggagtccaacactcccactaag
tctaagtctagtgatgaaagctgtgaatcagttgtaaccactgattcatccgaagaatgt
gaagattctgacgtggaagatcagagatggacatctcttcagtttgctgaagtcactgct
gtcttgaagaattttatgaggttgtcatcaaagtcgtgtagtagatgcaaaggaattaat
cctaaactcgagaagcctatgttcggatgggttcgcatgagagcaatgaaagactccgat
gttggagctaatgtcattcgagggcttaagctaaagaagtccactagcagtgttgaaaat
ccagatggctttgatgatagtggcattgatgcattatcagaagttgaagatggtgataaa
gagacaagagaaaagtccacggaagtagctgcagagtttgaagagcataattctaaaaga
gaccttttaccgagtgaggtcaggaatatcttaaaacatctgtggcagaatgagcacgag
ttttgctccttcattggtgatctttggcagagtgggtctgaaaaaattgactactctatg
ttttttttggagagtgttcttgtgccccctactaaatttagacctccaacaacaggaggt
gatagtgttatggaacatcctcaaaccgtaggactaaataaggtcatagaatccaataat
atactcgggaatgcctgtactaacaaattagatcagtcgaaggtaattttcagatggagg
aatcttcaagaatcagtcaatgtcttgtttgatagcaaaactgccacagttcaaagccag
agagacagctctggaatatgtcaattgctggagaagaaagaggggctatttcggcaaaaa
atgatgggaaagagagtgaatcatgcgtgcagatctgtgatatctccagatccttatatc
gctgttaatgacatcggaattcctccttgttttgctttgaaattgacgtatcccgagagg
gtgactccttggaatgtggagaagttaagggaagctatcattaatggtcctgacattcat
cctggagctacacattactctgacaaatcatctacaatgaagttgccctctaccgaaaaa
gcacgaagggcaattgcaagaaaattactgtcctcacgaggagccactacagaacttggg
aaaacttgtgatatcaactttgaaggtaaaactgtccatcgacatatgcgagatggtgac
atcgtccttgtgaatcgtcagccaacattacataaacctagcttaatggcgcacaaggtc
cgtgttctgaagggggagaaaacacttcgtctccactatgcaaattgcagtacatacaat
gcagattttgatggtgatgagatgaatgtgcattttccacaagatgagatttcacgtgct
gaggcctacaatattgtcaatgctaacaaccaatatgctaggccttctaatggcgagcca
cttcgagctttaattcaggatcatattgtcagttccgttttgcttactaaaagggacaca
tttttggacaaagatcattttaatcagcttctcttcagttccggtgtcactgacatggta
ctcagtactttttctggaagatctggcaagaaagtcatggtatcagcttctgatgcagaa
ctgttgacagtcacgcctgctattttgaagccagtgcctctttggactgggaagcaggtc
atcactgcagtgttgaatcagataaccaaaggtcacccgcctttcaccgtagagaaagct
accaaacttccagttgatttcttcaaatgtagatctagagaagtaaaacctaacagtgga
gatttgaccaaaaagaaagagattgacgagtcatggaaacagaatcttaatgaagataaa
ttgcacatcagaaaaaatgaattcgtctgcggtgtgatcgacaaggctcagtttgctgac
tatgggctggttcatacagtgcatgagctttatggttcaaatgctgcaggaaatctgctc
tctgtttttagtcgtctctttacagtctttcttcagacccacggtttcacctgtggcgtt
gatgatcttattattttaaaagatatggatgaagagaggacgaagcaacttcaagaatgt
gaaaatgttggtgaaagagtactccgtaaaacctttggcatagatgttgatgttcagata
gatcctcaggacatgagatccagaatagaacgaattctttatgaggacggggaatctgct
ttggcatctttggacaggagcatcgtaaattatctcaaccagtgttcaagcaagggtgtg
atgaacgatttactgtctgatgggttactaaaaacacctggaaggaattgtatatcgcta
atgacgatatctggggctaagggcagtaaggttaacttccagcaaatctcttcacacctt
ggccagcaagatttagaaggaaaaagagttccccgaatggtttctgggaagacattacct
tgtttccatccatgggactggtcccctagagctgggggatttattagtgacagattccta
agtggtcttcgcccccaagaatattacttccattgcatggctggacgagaagggttagtt
gatactgcagtgaagacatcgcgtagtgggtatctgcaaagatgcttgatgaaaaatctt
gagagtcttaaagtcaactatgattgtactgtccgggatgctgatgggtccatcattcag
ttccaatatggtgaagatggtgtggatgttcatcggtctagcttcattgaaaagttcaaa
gaactgacaataaatcaagatatggtccttcaaaaatgcagtgaagacatgctatctgga
gctagtagttacatcagtgatctgcctattagtcttaagaagggagctgagaagtttgta
gaggcaatgcctatgaatgaacgtattgcttctaaatttgtgagacaagaagaactactg
aagctggtgaagtcaaaattctttgcaagtcttgcgcagccaggggagcctgtaggtgta
cttgctgctcaatctgtaggagagccatcaacacagatgacgttgaatactttccatctt
gctggacgtggagagatgaatgtgacacttggaattccacgtttacaagagattttgatg
acagctgcagcaaacattaagacaccaataatgacatgcccgttgctgaaaggcaaaaca
aaggaggatgcaaatgatattactgataggttgaggaagataacggtggcagatataata
aagagcatggaactgtcagttgtaccatatacggtttatgagaatgaagtttgtagtatt
cacaagcttaagataaatctctataagccagagcattatccgaagcacaccgatatcact
gaagaagactgggaagagacgatgagggctgtatttttaaggaagttggaggacgctata
gagacccacatgaaaatgctccatagaataaggggcatacacaatgatgtcacaggtcca
atagctggaaatgaaactgataatgatgattctgtaagtggaaagcagaatgaagatgat
ggtgatgatgatggcgagggtacagaagttgatgatcttggttcagatgcacagaaacag
aagaaacaagaaacagatgagatggattatgaggaaaactctgaagatgagacgaacgaa
ccatcttcaatcagtggagtagaggaccctgagatggatagtgagaatgaggacacagaa
gttagcaaggaagatactccggaaccgcaggaagagtctatggaacctcaaaaagaggta
aaaggggtaaagaatgtcaaagaacagagtaaaaaaaagagacggaaatttgttcgagct
aaaagtgacagacatatctttgtgaaaggtgaaggagagaaatttgaggtccatttcaag
tttgctacagatgaccctcatattttacttgcccagattgctcaacaaacggcgcagaag
gtttacatccagaattctgggaagattgaacgatgcacagtggctaattgtggtgatcct
caggtgatctaccatggagacaatccaaaggagagaagagaaatatccaacgatgaaaag
aaagcctcaccagctctccacgcatcaggagttgatttccctgcactgtgggaattccaa
gataaacttgacgtcaggtacttgtatagcaacagcattcacgatatgctcaacattttt
ggagttgaagcagctagagaaacaataatcagggaaataaaccacgtcttcaaatcatat
ggcatttctgtaagcatcagacacttgaacctcattgcagattatatgaccttttccggt
ggataccgaccaatgagccgtatgggaggaattgcagaatcaacttcaccattctgcaga
atgacttttgaaacagccactaagttcattgtccaagcagctacttatggagaaaaggac
acattagaaaccccctctgctagaatctgtcttggcttgcctgcgctttcaggaactgga
tgcttcgatttgatgcagagagtggagctctga

DBGET integrated database retrieval system