KEGG   Arabidopsis thaliana (thale cress): AT4G01590
Entry
AT4G01590         CDS       T00041                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G01590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G01590
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT4G01590
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 Abp2
Other DBs
NCBI-GeneID: 828101
NCBI-ProteinID: NP_001031569
TAIR: AT4G01590
UniProt: F4JG25
Position
4:complement(688813..690460)
AA seq 199 aa
MSWKGARGKPKGYGGDYGKPEPFVIFPEITLPDPKSISTDSQLVQSYFTFNKFWRNSPYH
LGDGGVSKKEKESLNIERYSDSLKPKMKSNKNGSFFDFLVLRPDNFPKELLGDTRREQRP
VKRAKWSQEADLQKLDVFEKLEAKFKVEGKEEKEEGEDDEEVVESEGEESDNGDYDQNQD
FDDDDDDYNNEDDGFEEVY
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcttggaaaggagcccgaggaaaaccaaaaggctatggcggcgattatggcaagcct
gagccttttgtgattttccctgaaattacgttaccagatccaaaatcaatctcaacagac
tcgcaattagttcaaagctactttactttcaataagttttggaggaattctccttatcac
ttaggcgatggtggtgtttctaagaaagagaaagagagtttgaacattgagaggtactca
gattcgttgaagccgaagatgaagtctaataagaatggatctttctttgattttcttgtt
cttagacctgataacttccctaaagaacttcttggagatactcgaagagaacaacggcct
gtgaagagagctaaatggagtcaagaagctgatttgcagaaattggatgtgtttgagaag
cttgaagctaagtttaaggttgaaggcaaggaagagaaagaagaaggggaagatgatgaa
gaagttgtggaatcagaaggagaagaatctgataacggagattatgatcagaatcaagac
tttgatgatgatgacgacgattataataacgaggatgatggatttgaagaggtgtattaa

DBGET integrated database retrieval system