KEGG   Arabidopsis thaliana (thale cress): AT4G02460
Entry
AT4G02460         CDS       T00041                                 
Symbol
PMS1
Name
(RefSeq) DNA mismatch repair protein
  KO
K10858  DNA mismatch repair protein PMS2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT4G02460 (PMS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G02460 (PMS1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     AT4G02460 (PMS1)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c FAA_hydrolase_N
Other DBs
NCBI-GeneID: 827997
NCBI-ProteinID: NP_567236
TAIR: AT4G02460
UniProt: Q941I6
Position
4:complement(1076090..1080727)
AA seq 923 aa
MQGDSSPSPTTTSSPLIRPINRNVIHRICSGQVILDLSSAVKELVENSLDAGATSIEINL
RDYGEDYFQVIDNGCGISPTNFKVLALKHHTSKLEDFTDLLNLTTYGFRGEALSSLCALG
NLTVETRTKNEPVATLLTFDHSGLLTAEKKTARQIGTTVTVRKLFSNLPVRSKEFKRNIR
KEYGKLVSLLNAYALIAKGVRFVCSNTTGKNPKSVVLNTQGRGSLKDNIITVFGISTFTS
LQPVSICVSEDCRVEGFLSKPGQGTGRNLADRQYFFINGRPVDMPKVSKLVNELYKDTSS
RKYPVTILDFIVPGGACDLNVTPDKRKVFFSDETSVIGSLREGLNEIYSSSNASYIVNRF
EENSEQPDKAGVSSFQKKSNLLSEGIVLDVSSKTRLGEAIEKENPSLREVEIDNSSPMEK
FKFEIKACGTKKGEGSLSVHDVTHLDKTPSKGLPQLNVTEKVTDASKDLSSRSSFAQSTL
NTFVTMGKRKHENISTILSETPVLRNQTSSYRVEKSKFEVRALASRCLVEGDQLDDMVIS
KEDMTPSERDSELGNRISPGTQADNVERHEREHEKPIRFEEPTSDNTLTKGDVERVSEDN
PRCSQPLRSVATVLDSPAQSTGPKMFSTLEFSFQNLRTRRLERLSRLQSTGYVSKCMNTP
QPKKCFAAATLELSQPDDEERKARALAAATSELERLFRKEDFRRMQVLGQFNLGFIIAKL
ERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPEEEVTVLMHMDIIRENGF
LLEENPSAPPGKHFRLRAIPYSKNITFGVEDLKDLISTLGDNHGECSVASSYKTSKTDSI
CPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPWNCPHGRPTMRHLVDLTT
LLTLPDDDNVNDDDDDDATISLA
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgcaaggagattcttctccgtctccgacgactactagctctcctttgataagacctata
aacagaaacgtaattcacagaatctgttccggtcaagtcatcttagacctctcttcggcc
gtcaaggagcttgtcgagaatagtctcgacgccggcgccaccagtatagagattaacctc
cgagactacggcgaagactattttcaggtcattgacaatggttgtggcatttccccaacc
aatttcaaggttcttgcacttaagcatcatacttctaaattagaggatttcacagatctt
ttgaatttgactacttatggttttagaggagaagccttgagctctctctgtgcattggga
aatctcactgtggaaacaagaacaaagaatgagccagttgctacgctcttgacgtttgat
cattctggtttgcttactgctgaaaagaagactgctcgccaaattggtaccactgtcact
gttaggaagttgttctctaatttacctgtacgaagcaaagagtttaagcggaatatacgc
aaagaatatgggaagcttgtatctttattgaacgcatatgcgcttattgcgaaaggagtg
cggtttgtctgctctaacacgactgggaaaaacccaaagtctgttgtgctgaacacacaa
gggaggggttcacttaaagataatatcataacagttttcggcattagtacctttacaagt
ctacagcctgtaagtatatgtgtatcagaagattgtagagttgaagggtttctttccaag
cctggacagggtactggacgcaatttagcagatcgacagtatttctttataaatggtcgg
cctgtagatatgccaaaagtcagcaagttggtgaatgagttatataaagatacaagttct
cggaaatatccagttaccattctggattttattgtgcctggtggagcatgtgatttgaat
gtcacgcccgataaaagaaaggtgttcttttctgacgagacttctgttatcggttctttg
agggaaggtctgaacgagatatattcctccagtaatgcgtcttatattgttaataggttc
gaggagaattcggagcaaccagataaggctggagtttcgtcgtttcagaagaaatcaaat
cttttgtcagaagggatagttctggatgtcagttctaaaacaagactaggggaagctatt
gagaaagaaaatccatccttaagggaggttgaaattgataatagttcgccaatggagaag
tttaagtttgagatcaaggcatgtgggacgaagaaaggggaaggttctttatcagtccat
gatgtaactcaccttgacaagacacctagcaaaggtttgcctcagttaaatgtgactgag
aaagttactgatgcaagtaaagacttgagcagccgctctagctttgcccagtcaactttg
aatacttttgttaccatgggaaaaagaaaacatgaaaacataagcaccatcctctctgaa
acacctgtcctcagaaaccaaacttctagttatcgtgtggagaaaagcaaatttgaagtt
cgtgccttagcttcaaggtgtctcgtggaaggcgatcaacttgatgatatggtcatctca
aaggaagatatgacaccaagcgaaagagattctgaactaggcaatcggatttctcctgga
acacaagctgataatgttgaaagacatgagagagaacatgaaaagcctataaggtttgaa
gaaccaacatcagataacacactcaccaagggggatgtggaaagggtttcagaggacaat
ccacggtgcagtcagccactgcgatctgtggccacagtgctggattccccagctcagtca
accggtcctaaaatgttttccacattagaatttagtttccaaaacctcaggacaaggagg
ttagagaggctgtcgagattgcagtccacaggttatgtatctaaatgtatgaatacgcca
cagcctaaaaagtgctttgccgctgcaacattagagttatctcaaccggatgatgaagag
cgaaaagcaagggctttagctgcagctacttctgagctggaaaggctttttcgaaaagag
gatttcaggagaatgcaggtactcgggcaattcaatcttgggttcatcattgcaaaattg
gagcgagatctgttcattgtggatcagcatgcagctgatgagaaattcaacttcgaacat
ttagcaaggtcaactgtcctgaaccagcaacccttactccagcctttgaacttggaactc
tctccagaagaagaagtaactgtgttaatgcacatggatattatcagggaaaatggcttt
cttctagaggagaatccaagtgctcctcccggaaaacactttagactacgagccattcct
tatagcaagaatatcacctttggagtcgaagatcttaaagacctgatctcaactctagga
gataaccatggggaatgttcggttgctagtagctacaaaaccagcaaaacagattcgatt
tgtccatcacgagtccgtgcaatgctagcatcccgagcatgcagatcatctgtgatgatc
ggagatccactcagaaaaaacgaaatgcagaagatagtagaacacttggcagatctcgaa
tctccttggaattgcccacacggacgaccaacaatgcgtcatcttgtggacttgacaact
ttactcacattacctgatgacgacaatgtcaatgatgatgatgatgatgatgcaaccatc
tcattggcatga

DBGET integrated database retrieval system