KEGG   Arabidopsis thaliana (thale cress): AT4G09140
Entry
AT4G09140         CDS       T00041                                 
Symbol
MLH1
Name
(RefSeq) MUTL-homologue 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT4G09140 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G09140 (MLH1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     AT4G09140 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 826493
NCBI-ProteinID: NP_567345
TAIR: AT4G09140
UniProt: Q9ZRV4
Position
4:complement(5816942..5821066)
AA seq 737 aa
MIDDSSLTAEMEEEESPATTIVPREPPKIQRLEESVVNRIAAGEVIQRPVSAVKELVENS
LDADSSSISVVVKDGGLKLIQVSDDGHGIRREDLPILCERHTTSKLTKFEDLFSLSSMGF
RGEALASMTYVAHVTVTTITKGQIHGYRVSYRDGVMEHEPKACAAVKGTQIMVENLFYNM
IARRKTLQNSADDYGKIVDLLSRMAIHYNNVSFSCRKHGAVKADVHSVVSPSRLDSIRSV
YGVSVAKNLMKVEVSSCDSSGCTFDMEGFISNSNYVAKKTILVLFINDRLVECSALKRAI
EIVYAATLPKASKPFVYMSINLPREHVDINIHPTKKEVSLLNQEIIIEMIQSEVEVKLRN
ANDTRTFQEQKVEYIQSTLTSQKSDSPVSQKPSGQKTQKVPVNKMVRTDSSDPAGRLHAF
LQPKPQSLPDKVSSLSVVRSSVRQRRNPKETADLSSVQELIAGVDSCCHPGMLETVRNCT
YVGMADDVFALVQYNTHLYLANVVNLSKELMYQQTLRRFAHFNAIQLSDPAPLSELILLA
LKEEDLDPGNDTKDDLKERIAEMNTELLKEKAEMLEEYFSVHIDSSANLSRLPVILDQYT
PDMDRVPEFLLCLGNDVEWEDEKSCFQGVSAAIGNFYAMHPPLLPNPSGDGIQFYSKRGE
SSQEKSDLEGNVDMEDNLDQDLLSDAENAWAQREWSIQHVLFPSMRLFLKPPASMASNGT
FVKVASLEKLYKIFERC
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgatcgacgattcgtctcttacggcggagatggaggaggaagaatctccggcgacgacg
attgtaccgagagagccaccgaagattcaacgcttagaagaatcagtagtcaaccgtatc
gcagctggtgaagtaatccagcgtccagtttcagctgtgaaagagctcgttgagaacagc
ctcgacgccgattcaagttccataagcgtcgttgtcaaagacggtggtttgaaactcatt
caagtctccgacgacggtcacggtattagacgtgaagacttgccgatactatgcgagaga
catacaacatcgaagctgactaagtttgaggatttgttctctctgagttcaatgggattt
agaggagaggcattagctagtatgacctatgttgctcatgttacagtgactactattact
aaaggccagattcatggttatagagtgtcttatagagatggtgtcatggagcatgaacca
aaggcgtgtgctgctgtcaaaggaacacagataatggtggagaatttgttctacaatatg
attgctagaaggaagacacttcaaaattctgctgatgattacgggaaaatcgtggatttg
ctgagccggatggctattcattacaataatgtcagcttttcttgtcgaaagcatggagct
gttaaggctgatgttcactcagtcgtgtcaccttcaaggcttgattcaattaggtctgta
tatggagtatcagttgcaaagaacttgatgaaagtagaagtttcctcctgtgactcctct
ggttgtacttttgatatggagggtttcatatccaattctaactatgttgctaagaagact
atattggtgcttttcattaatgatagattggtggaatgctctgccttaaaaagagccatt
gaaattgtttatgctgcaacattgccaaaagcatcaaaaccttttgtctacatgtcaatc
aatttgccacgggaacatgttgatatcaatattcacccaacaaagaaagaggttagcctt
ctaaaccaggaaatcattattgagatgatacagtcagaggttgaagtaaaactgagaaac
gcaaatgatactaggacgtttcaagagcagaaagtggaatacattcaatctacgttaaca
tctcagaaaagtgattctccagtttctcagaagccttctggacaaaagacacagaaagtt
cctgtgaacaaaatggtgagaacagattcatcagatccagctggaaggttacatgccttt
ttgcaacccaagccacaaagtctccctgacaaggtttctagtttgagtgtagtaaggtct
tctgtaaggcaaagaagaaacccaaaggaaactgctgatctttctagtgtccaggaactt
attgctggagttgacagctgctgccatccaggtatgctggagactgtaaggaattgcaca
tatgttggaatggcagatgatgtttttgctttagttcagtataacacccatctatatcta
gcaaatgtggtgaatctcagcaaagagctaatgtatcagcaaactcttcgtcgttttgct
cattttaacgcaatacagcttagcgatccagcccctttgtcagagttgatattgttggct
ctgaaagaggaggatctagatccaggaaatgatacaaaagatgatctgaaagaaagaatt
gctgaaatgaatacagaactcctcaaggaaaaagcagaaatgttagaggagtatttcagc
gtgcacattgactccagtgcaaatttgtcaaggcttcctgtgatactcgaccagtataca
cctgacatggatcgtgttcctgaatttttactatgcttgggaaatgatgttgagtgggaa
gatgagaagagttgctttcaaggagtttctgcagctattgggaacttttacgccatgcat
cctcctcttttgccaaacccatcgggtgacggtattcagttctatagtaagagaggtgag
agctctcaggaaaagtcagatttagagggtaacgtcgatatggaggacaatcttgaccaa
gatcttctgtcagatgctgaaaacgcatgggcacaacgtgaatggtcaatccaacacgtg
ttgtttccgtcaatgagattgttcttgaagccaccagcttccatggcttcaaatgggact
tttgtaaaggtagcatcccttgaaaagctgtacaagatattcgaacgatgctaa

DBGET integrated database retrieval system