KEGG   Arabidopsis thaliana (thale cress): AT4G20210
Entry
AT4G20210         CDS       T00041                                 
Name
(RefSeq) Terpenoid cyclases/Protein prenyltransferases superfamily protein
  KO
K22467  rhizathalene A synthase [EC:4.2.3.195]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT4G20210
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.195  rhizathalene A synthase
     AT4G20210
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-GeneID: 827768
NCBI-ProteinID: NP_193754
TAIR: AT4G20210
UniProt: O65435
Position
4:complement(10913470..10918371)
AA seq 600 aa
MEAIKTFSPKFGFQISLSPRTHLTPVRFPPTACPVKPANLVRLKATRALIRDPQESNRKF
QKFPPSEWTNRFDSVSVDASEMDALRKEIDKIIPNVKKELMSSQGIESTKKKILMVYLLV
SLGLAYHFEDEIEECLKEGFETIEEMMAGEDNLYTISIIFLVLRTYGHHMSSDIFQKFKG
NDGNFKGCISGDAKGLLALYEAAQLRTTTEYIMEEALSFTSSNLELLAADGRCPPHLSKH
IRNALGLSQHKQMEVLVAVEYISFYEQEKDHDKILLKFAKLNFKLMQLHYLEELKVVTKW
YKEHDFASNLPPYFKYVIVENHFFAITMYFEPKFSQKRIMLAKYFTVLVLLDDTCDRYAS
LSEAESLTNSLERWAPDDAMDKQPHYLKFVFKFIMGCFEEFERELASEGRSYSVKATLEE
FKTIVKANFDFAKLAHTGHVPSFKEYMEVGEVEVGVCATLAGNLMCIGHIGDEGVYEWLK
SRPKFLKAASTYGRLMNDIAGFEDDMKREYVITGVNTYMKQYGLTKMEAIRELQNLVEYN
HTIMNEEFLKTTDLPRQIRKQVINVARSLNVSYTEGEGFTHTKGKVDEYITSLFITPIRI
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggaagccataaaaactttttcaccaaaatttggattccaaatctctctttctcctcgt
acccatttaactccagtcagatttccaccgacagcatgtccagttaagcctgctaatctt
gtccgtttgaaggcaactagagctctgattcgtgatcctcaagaaagtaaccgtaagttc
caaaagttcccaccttctgaatggactaatcgcttcgactctgtctcggtagatgcatcg
gaaatggatgcgcttaggaaagagatcgataagattataccgaacgtgaagaaggaactc
atgtcttcccaaggcattgaatcgacgaagaaaaaaatccttatggtatatttgctggtt
agccttggtcttgcttatcacttcgaagatgagattgaagagtgtctgaaagagggtttc
gaaacaatagaagagatgatggctggtgaagataatttgtatactatttcaatcatcttt
ttggttttaaggacatacggtcaccatatgtcatccgacatatttcagaaattcaaagga
aacgatggaaattttaaaggatgcattagtggggacgctaagggtttgttggccttgtat
gaagccgcgcaattgagaacgactacagagtatataatggaagaagcactgagcttcaca
tcgagcaatttggagttgttagctgcagatgggaggtgcccacctcatctctcaaaacat
atacgaaatgctctaggactatctcagcataaacagatggaggtgttagtagctgtggaa
tatatctcattctatgaacaagaaaaagatcacgacaaaatactgctaaaatttgcgaag
ctcaatttcaagttaatgcagctccattaccttgaagagctcaaggtcgttacaaaatgg
tacaaggaacacgattttgcatctaacttgccaccttacttcaaatacgtaatcgtggag
aatcatttctttgcaataacgatgtacttcgagccaaaattctcacaaaagcggattatg
ctggctaagtactttacggttttagtacttctagatgacacttgtgatagatacgcatct
ctttctgaggccgaaagcctcaccaatagtctggagaggtgggctcctgatgatgctatg
gataaacagccacattatttgaaattcgtgtttaagtttataatgggttgcttcgaagag
tttgaaagagaattggcgtcagaaggaagatcttactctgtgaaagccacactagaagag
tttaagacaattgtgaaagccaactttgattttgcaaaattggcacacacgggtcacgtg
cctagttttaaggagtacatggaagttggtgaggtggaggttggggtatgtgcgactttg
gcaggcaatctgatgtgtatcggacatatcggtgatgagggagtttatgagtggctcaaa
tccagaccaaaatttctcaaagcagcctctacatatgggcgtctgatgaatgatatagcc
ggatttgaggatgacatgaaaagagaatatgtcattacgggagtcaacacttatatgaag
caatatggtctaaccaaaatggaagctatcagagagcttcaaaacttagttgaatacaac
catacgataatgaacgaagagtttttgaagacaactgatttaccacgccaaattcggaaa
caagtcatcaacgttgcacgctctctcaacgtctcctatactgaaggtgaaggatttacc
cataccaaaggaaaagtcgatgagtatatcacttctttgtttattaccccgattcgtatt
tga

DBGET integrated database retrieval system