KEGG   Arabidopsis thaliana (thale cress): AT4G20930
Entry
AT4G20930         CDS       T00041                                 
Name
(RefSeq) 6-phosphogluconate dehydrogenase family protein
  KO
K23146  3-hydroxyisobutyrate/3-hydroxypropionate dehydrogenase [EC:1.1.1.31 1.1.1.59]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00280  Valine, leucine and isoleucine degradation
ath00410  beta-Alanine metabolism
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT4G20930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT4G20930
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G20930
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     AT4G20930
    1.1.1.59  3-hydroxypropionate dehydrogenase
     AT4G20930
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C 3HCDH_N Shikimate_DH NAD_binding_7 TrkA_N HTH_10 Coiled
Other DBs
NCBI-GeneID: 827841
NCBI-ProteinID: NP_567617
TAIR: AT4G20930
UniProt: Q9SUC0
Position
4:complement(11198251..11201106)
AA seq 347 aa
MAIRRAQTLLCLSKFKTNFVSGSLHRFSSSSQNSNQFQNVGFIGLGNMGFRMVNNLIRAG
YKVTVHDINRDVMKMFTEMGVSSRETPYEVAQDSEVVITMLPSSSHVMDVYTGTNGLLLG
ENDIRPALFIDSSTIDPQTTRKISLAVSNCNLKEKRDNWEKPVMLDAPVSGGVLAAEAGT
LTFMVGGPEDAYLAARPILQSMGRTSIYCGGSGNGSAAKICNNLAMAVSMLGTSEALALG
QSLGISASTLTEVLNTSSGRCWSSDAYNPVPGVMKGVPSSRDYNGGFASKLMAKDLNLAA
ASAEEVGHKSPLISKAQEIYKKMCEEGHETKDFSCVFRHFYNGKDEV
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcgattcgcagagcgcaaactctactttgtctttctaaattcaaaaccaatttcgtg
tctgggtcgctccaccggttctcttcttcgtctcaaaattcaaatcaattccagaatgtt
ggtttcataggacttggaaatatgggattcagaatggtgaataatctaattagagctgga
tataaagttaccgttcatgacataaaccgtgatgttatgaaaatgttcactgaaatggga
gtctcttctagagaaactccttatgaagttgcacaagatagcgaagttgtgattacaatg
ttgccttcatcatctcatgtgatggatgtgtacacaggaacaaatgggttgcttcttgga
gaaaatgatataagacctgctttgtttatagattcatccactattgatccacaaacaact
cgaaaaatctcacttgctgtttctaattgtaatttgaaagaaaagagagataattgggaa
aagccagtcatgttggatgctcccgtctctggaggtgttcttgctgcagaagctggtaca
cttactttcatggttggaggtcccgaagatgcttacttagccgctagaccaatacttcag
tcaatgggcagaacctccatctactgtggtggttcaggaaatggatctgccgcaaagatt
tgtaacaatctggcaatggccgtgagtatgctcggcacttcagaagccttagctcttggt
cagtcacttggaatatctgccagtactttaacagaagtcttaaacacatctagtggccgt
tgttggagcagtgacgcatacaatccagttccaggagtgatgaaaggtgtgccatcttca
agggattacaatggcggtttcgcctccaaacttatggctaaagacctaaacctcgcagca
gcctcagctgaagaagttggacacaaaagcccattgatatccaaagcacaagaaatttac
aagaagatgtgcgaggaaggacatgaaacgaaggacttctcttgtgttttcagacacttt
tacaatgggaaagatgaggtctga

DBGET integrated database retrieval system