KEGG   Arabidopsis thaliana (thale cress): AT4G21710
Entry
AT4G21710         CDS       T00041                                 
Symbol
NRPB2
Name
(RefSeq) DNA-directed RNA polymerase family protein
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G21710 (NRPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G21710 (NRPB2)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G21710 (NRPB2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT4G21710 (NRPB2)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     AT4G21710 (NRPB2)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT4G21710 (NRPB2)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_3 RNA_pol_Rpb2_4 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 828259
NCBI-ProteinID: NP_193902
TAIR: AT4G21710
UniProt: P38420 A0A178V2G7
Position
4:complement(11535404..11542405)
AA seq 1188 aa
MEYNEYEPEPQYVEDDDDEEITQEDAWAVISAYFEEKGLVRQQLDSFDEFIQNTMQEIVD
ESADIEIRPESQHNPGHQSDFAETIYKISFGQIYLSKPMMTESDGETATLFPKAARLRNL
TYSAPLYVDVTKRVIKKGHDGEEVTETQDFTKVFIGKVPIMLRSSYCTLFQNSEKDLTEL
GECPYDQGGYFIINGSEKVLIAQEKMSTNHVYVFKKRQPNKYAYVGEVRSMAENQNRPPS
TMFVRMLARASAKGGSSGQYIRCTLPYIRTEIPIIIVFRALGFVADKDILEHICYDFADT
QMMELLRPSLEEAFVIQNQLVALDYIGKRGATVGVTKEKRIKYARDILQKEMLPHVGIGE
HCETKKAYYFGYIIHRLLLCALGRRPEDDRDHYGNKRLDLAGPLLGGLFRMLFRKLTRDV
RSYVQKCVDNGKEVNLQFAIKAKTITSGLKYSLATGNWGQANAAGTRAGVSQVLNRLTYA
STLSHLRRLNSPIGREGKLAKPRQLHNSQWGMMCPAETPEGQACGLVKNLALMVYITVGS
AAYPILEFLEEWGTENFEEISPSVIPQATKIFVNGMWVGVHRDPDMLVKTLRRLRRRVDV
NTEVGVVRDIRLKELRIYTDYGRCSRPLFIVDNQKLLIKKRDIYALQQRESAEEDGWHHL
VAKGFIEYIDTEEEETTMISMTISDLVQARLRPEEAYTENYTHCEIHPSLILGVCASIIP
FPDHNQSPRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQL
PAGINAIVAISCYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRP
DRGSTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQGQSSRYTRRDHSI
SLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDM
PWTIEGVTPDIIVNPHAIPSRMTIGQLIECIMGKVAAHMGKEGDATPFTDVTVDNISKAL
HKCGYQMRGFERMYNGHTGRPLTAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQPA
EGRSRDGGLRFGEMERDCMIAHGAAHFLKERLFDQSDAYRVHVCEVCGLIAIANLKKNSF
ECRGCKNKTDIVQVYIPYACKLLFQELMSMAIAPRMLTKHLKSAKGRQ
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggagtacaacgaatacgaacctgaacctcaatatgtagaagacgatgacgatgaggag
attacccaggaggacgcgtgggctgttatatctgcttatttcgaagagaaaggtctcgtt
cgtcaacagctggattcgtttgatgagtttattcaaaatactatgcaagaaatcgttgat
gagtctgctgatatcgagatccgacctgaatctcagcataatcctggccatcagtccgat
tttgcggagacaatctacaagattagctttggacagatttatctgagtaaacctatgatg
acagagtctgatggagagactgccaccctgttccctaaggctgcaaggttgagaaatctc
acatactctgcgcctttgtatgtcgatgttactaagagagttattaagaaagggcatgat
ggtgaagaagttacggagacacaggattttactaaagttttcattggaaaggttcccatc
atgctccggtctagttactgtaccttgtttcagaactcggagaaagacctgacagagctt
ggagaatgtccttatgatcagggtggatacttcattattaatggcagtgaaaaggttctg
attgctcaggagaagatgagtacgaatcatgtttatgtgttcaagaaaaggcagccaaat
aagtatgcttatgttggtgaagtccgttctatggctgaaaaccaaaataggcctccaagc
acaatgtttgtgcgtatgcttgctcgtgctagtgcaaaagggggttcatctggacagtat
attcgatgtactcttccatacatcagaacagaaattcctattatcatagtatttcgtgca
ctgggatttgttgccgataaggacatattggaacacatctgctatgattttgccgatacc
cagatgatggagttgctcaggccttccttggaagaagctttcgttattcaaaatcagctg
gttgcacttgactatattggaaaacgtggtgcaactgttggtgtaaccaaggaaaaaagg
ataaagtatgctagagatatccttcagaaagaaatgcttcctcatgtaggaattggggag
cattgcgagacaaagaaagcttactattttgggtatatcatacaccggctgctgctttgt
gcacttggccgaaggccagaagatgatagggatcattatggtaacaaaaggctggatctt
gctggtcctttacttggagggctatttagaatgcttttccgaaagttaacaagggatgtg
agatcttatgttcaaaagtgcgttgacaatggcaaagaagtcaatcttcaatttgccatt
aaggctaaaacaattacctctggcctgaaatattctcttgctactgggaactggggccag
gcaaacgctgctggcacaagagctggagtctctcaggttcttaaccggttgacatatgct
tcgactttgtcacatctgaggcgtctcaattctccaataggacgtgaaggaaaattggca
aaaccaagacaactgcacaactcacagtggggaatgatgtgccctgctgaaacacctgaa
ggacaggcttgtggtctagtgaaaaacttggctctcatggtctacataacagttgggtca
gctgcttatcctatattggaatttttggaagaatggggtactgagaattttgaggaaata
tctccatctgttataccccaagccacaaaaatctttgtcaatggaatgtgggttggagtt
catagagatcctgacatgttggtgaaaacgttgagacgtttgagacgaagggttgatgtc
aacactgaagttggtgtagttagagatatccgtcttaaagagctccggatatacactgat
tatggacgttgtagccgtccgttgtttattgtagataatcagaagctcttaataaagaag
agagatatctatgctctgcaacaaagggaaagtgcagaagaagatggttggcatcatctg
gttgctaagggctttatagaatacatagacacagaagaagaggaaacgaccatgatttcc
atgactatcagtgatctggttcaagctagactccgcccagaagaggcttatactgaaaac
tacacacattgtgagattcacccatctctgatattgggggtctgtgcttcaatcatacca
tttcctgaccataatcagtcacctcgtaatacatatcaatctgccatggggaagcaagca
atgggaatttatgtcaccaactaccaatttcgcatggatacgttagcttatgttctctat
tatccacaaaagcctttggttactacaagagctatggagcatcttcactttagacaactt
ccagcaggaattaatgctattgttgccatttcttgctattctggatataatcaagaagat
tctgtcatcatgaatcagtcttcaatagatcgtggtttctttcgatccttgttctttcgg
tcttacagagatgaggagaaaaaaatggggacgcttgtcaaagaagactttgggcgccca
gacagaggaagtacaatgggtatgcgacatggttcttatgataaactggatgatgatggt
cttgcgcctcctggtactagagtttcaggtgaagatgttatcattgggaaaaccactcca
atatctcaagatgaggctcaaggacaatcatcccgatacactagacgtgatcatagtata
agcttgcgacatagtgaaactggaatggtggatcaggtgttattgactacaaatgcagat
ggtttgaggtttgtgaaagtgagggtcagatccgtgcggattcctcaaattggagacaaa
tttagtagtagacacggtcagaagggaactgttggcatgacctacacgcaggaggatatg
ccatggacgattgaaggggtcactccggacattattgtgaatccacatgctattccgtct
cgaatgacaattggacagctaattgagtgcatcatgggaaaagtggcagctcacatggga
aaagaaggagatgctactccctttacagatgtcacggtggataatataagcaaagccctt
cataagtgtgggtaccaaatgcgtggatttgagagaatgtacaatggtcacacgggcaga
ccactcacagctatgatattccttggaccaacatattaccaaagattgaagcatatggtt
gatgacaagattcactcgcgtggacgaggtccggtgcaaatcttaacaagacaaccagct
gaagggcgatcacgtgatggtggtctccgttttggagaaatggagcgcgattgcatgatt
gcacatggtgctgctcactttttgaaagagaggctgtttgatcagagtgatgcgtatagg
gtacatgtgtgtgaagtctgcgggctcattgccattgcaaatctgaagaagaattctttt
gaatgcagaggttgcaagaacaaaacagatattgttcaggtatacattccatatgcttgc
aaattactctttcaagagcttatgtcaatggctattgcaccaaggatgctcactaaacac
ctgaaatcggctaaaggcagacagtga

DBGET integrated database retrieval system