KEGG   Arabidopsis thaliana (thale cress): AT4G25180
Entry
AT4G25180         CDS       T00041                                 
Name
(RefSeq) RNA polymerase III RPC4
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G25180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G25180
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT4G25180
SSDB
Motif
Pfam: RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 828621
NCBI-ProteinID: NP_194248
TAIR: AT4G25180
UniProt: A0A178UX81 Q6ICW8
Position
4:complement(12911550..12914039)
AA seq 311 aa
MDSGEQKSKRRFQPNPPRPSRRLPIAPTSNTEAEEDEENIKASRQFDRRIVGRRPKTETK
ASSPEVAFQPSLSPLAIRSFGVPKEDDKPNSDVNPSSPASILPAVSSVTAAQEDGEEVHN
FVTRTGDDYVEPWDYRNSYYPTVLPLRKPNSGDIELLDQEEFGEVAKNRDYDENTINSAE
ELGLTSVQHSKKQMFIFKIPDCLPVVKQTTGATTKRSVREYSSGISNPFEGLPEGFMGKM
LVYKSGAVKLKVGDALFDVSPGPGTKIPNDVVAIDIKGRNCSRIGSSAKFVTVTPDVESL
LNPASDMETQK
NT seq 936 nt   +upstreamnt  +downstreamnt
atggattcaggcgaacaaaagtctaagcggaggttccaaccaaatcctccgaggccttct
cgccgtcttccgatcgctccaacctcaaacaccgaagctgaggaggatgaagagaatata
aaagcatctcgccaatttgacagacgtatcgtcggcaggagacccaaaaccgaaacgaaa
gcttcttctcctgaagttgcattccaaccaagcttgtcaccacttgcaataaggtccttt
ggtgttcctaaagaagatgacaagcccaattctgatgttaatccgtcttctcctgctagt
attcttcctgctgtttcgtctgttactgctgcccaagaagatggagaagaggttcataat
tttgttacaagaactggggatgactacgttgaaccttgggattatagaaactcctactat
cctactgttcttcctttgagaaagcctaactctggtgatatagaacttcttgaccaggag
gaatttggggaggtggctaaaaaccgtgattatgatgagaacaccatcaactccgcagaa
gaactcggtctgacatcggtgcaacacagcaaaaaacagatgtttatctttaagatccca
gactgtctccctgtagtgaagcaaacgacaggagcaaccaccaagagatcggtacgggag
tatagttcagggataagcaacccttttgaaggtttaccagagggattcatgggcaaaatg
ctggtttacaagagcggtgctgtcaagttgaaagttggagatgccctctttgatgtctcg
ccaggtccaggtacaaaaatccctaatgatgtggtagcaatagacatcaaagggaggaac
tgcagtcgcattggttcttcagcgaagtttgttactgttactcccgatgttgagtctctt
ttgaaccctgcttcagacatggaaacacagaagtga

KEGG   Arabidopsis thaliana (thale cress): AT5G09380
Entry
AT5G09380         CDS       T00041                                 
Name
(RefSeq) RNA polymerase III RPC4
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G09380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G09380
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT5G09380
SSDB
Motif
Pfam: RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 830797
NCBI-ProteinID: NP_001318517
TAIR: AT5G09380
UniProt: F4KCL0
Position
5:complement(2911177..2913324)
AA seq 216 aa
MYHTVPASQVAWLGGVVNSTRSNKYLNRSNGAYGSTSTQEIEYKEPWDYYSYYPITLPMR
RPYAGDPEVLDVEEFMQAGGHHEDSLNTAANLGLMEDSGEQKMFFMRLPSVPLASTPTEN
LETRPNIKGPVEKKTVDLKALPEGYMGKLLVYKSGAVKMKLGEVLYDVSPGLKSEFAQDV
MVVNTEQKNCCLVGDVYKHAVLTPDIDSILKDIENI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgtatcatacagttcctgcttctcaagttgcttggttggggggagtggtgaattcaacc
agatcaaataagtacctcaatagatcaaatggtgcttatggatcaacctctactcaggag
atagagtataaagaaccatgggattactacagctattaccctatcacacttccaatgagg
agaccgtatgcaggagatccagaggttcttgacgtggaggagtttatgcaggctggagga
catcatgaagattcacttaacacagccgctaatctcggtctaatggaggatagtggagaa
cagaaaatgttttttatgaggctaccttctgttcctttggcatcaacaccaacagaaaac
cttgaaacaaggccaaatatcaaaggccccgttgagaagaagactgttgatttaaaagcc
ttgccagaaggttacatgggcaaactgttagtctacaaaagtggtgctgtcaagatgaaa
cttggggaagtgctttatgatgtaagcccagggttgaagagcgagtttgcacaagatgtg
atggtggttaacacagagcagaagaactgttgtctggttggagatgtgtacaagcatgca
gttttgactcctgatattgattcaatcttgaaagatatcgaaaatatatga

DBGET integrated database retrieval system