KEGG   Arabidopsis thaliana (thale cress): AT4G25540
Entry
AT4G25540         CDS       T00041                                 
Symbol
MSH3
Name
(RefSeq) homolog of DNA mismatch repair protein MSH3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT4G25540 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G25540 (MSH3)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AT4G25540 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-GeneID: 828659
NCBI-ProteinID: NP_194284
TAIR: AT4G25540
UniProt: O65607 A0A5S9XVR3
Position
4:complement(13042455..13048262)
AA seq 1081 aa
MGKQKQQTISRFFAPKPKSPTHEPNPVAESSTPPPKISATVSFSPSKRKLLSDHLAAASP
KKPKLSPHTQNPVPDPNLHQRFLQRFLEPSPEEYVPETSSSRKYTPLEQQVVELKSKYPD
VVLMVEVGYRYRFFGEDAEIAARVLGIYAHMDHNFMTASVPTFRLNFHVRRLVNAGYKIG
VVKQTETAAIKSHGANRTGPFFRGLSALYTKATLEAAEDISGGCGGEEGFGSQSNFLVCV
VDERVKSETLGCGIEMSFDVRVGVVGVEISTGEVVYEEFNDNFMRSGLEAVILSLSPAEL
LLGQPLSQQTEKFLVAHAGPTSNVRVERASLDCFSNGNAVDEVISLCEKISAGNLEDDKE
MKLEAAEKGMSCLTVHTIMNMPHLTVQALALTFCHLKQFGFERILYQGASFRSLSSNTEM
TLSANTLQQLEVVKNNSDGSESGSLFHNMNHTLTVYGSRLLRHWVTHPLCDRNLISARLD
AVSEISACMGSHSSSQLSSELVEEGSERAIVSPEFYLVLSSVLTAMSRSSDIQRGITRIF
HRTAKATEFIAVMEAILLAGKQIQRLGIKQDSEMRSMQSATVRSTLLRKLISVISSPVVV
DNAGKLLSALNKEAAVRGDLLDILITSSDQFPELAEARQAVLVIREKLDSSIASFRKKLA
IRNLEFLQVSGITHLIELPVDSKVPMNWVKVNSTKKTIRYHPPEIVAGLDELALATEHLA
IVNRASWDSFLKSFSRYYTDFKAAVQALAALDCLHSLSTLSRNKNYVRPEFVDDCEPVEI
NIQSGRHPVLETILQDNFVPNDTILHAEGEYCQIITGPNMGGKSCYIRQVALISIMAQVG
SFVPASFAKLHVLDGVFTRMGASDSIQHGRSTFLEELSEASHIIRTCSSRSLVILDELGR
GTSTHDGVAIAYATLQHLLAEKRCLVLFVTHYPEIAEISNGFPGSVGTYHVSYLTLQKDK
GSYDHDDVTYLYKLVRGLCSRSFGFKVAQLAQIPPSCIRRAISMAAKLEAEVRARERNTR
MGEPEGHEEPRGAEESISALGDLFADLKFALSEEDPWKAFEFLKHAWKIAGKIRLKPTCS
F
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgggcaagcaaaagcagcagacgatttctcgtttcttcgctcccaaacccaaatccccg
actcacgaaccgaatccggtagccgaatcatcaacaccgccaccgaagatatccgccact
gtatccttctctccttccaagcgtaagcttctctccgaccacctcgccgccgcgtcaccc
aaaaagcctaaactttctcctcacactcaaaacccagtacccgatcccaatttacaccaa
agatttctccagagatttctggaaccctcgccggaggaatatgttcccgaaacgtcatca
tcgaggaaatacacaccattggaacagcaagtggtggagctaaagagcaagtacccagat
gtggttttgatggtggaagttggttacaggtacagattcttcggagaagacgcggagatc
gcagcacgcgtgttgggtatttacgctcatatggatcacaatttcatgacggcgagtgtg
ccaacatttcgattgaatttccatgtgagaagactggtgaatgcaggatacaagattggt
gtagtgaagcagactgaaactgcagccattaagtcccatggtgcaaaccggaccggccct
tttttccggggactgtcggcgttgtataccaaagccacgcttgaagcggctgaggatata
agtggtggttgtggtggtgaagaaggttttggttcacagagtaatttcttggtttgtgtt
gtggatgagagagttaagtcggagacattaggctgtggtattgaaatgagttttgatgtt
agagtcggtgttgttggcgttgaaatttcgacaggtgaagttgtttatgaagagttcaat
gataatttcatgagaagtggattagaggctgtgattttgagcttgtcaccagctgagctg
ttgcttggccagcctctttcacaacaaactgagaagtttttggtggcacatgctggacct
acctcaaacgttcgagtggaacgtgcctcactggattgtttcagcaatggtaatgcagta
gatgaggttatttcattatgtgaaaaaatcagcgcaggtaacttagaagatgataaagaa
atgaagctggaggctgctgaaaaaggaatgtcttgcttgacagttcatacaattatgaac
atgccacatctgactgttcaagccctcgccctaacgttttgccatctcaaacagtttgga
tttgaaaggatcctttaccaaggggcctcatttcgctctttgtcaagtaacacagagatg
actctctcagccaatactctgcaacagttggaggttgtgaaaaataattcagatggatcg
gaatctggctccttattccataatatgaatcacacacttacagtatatggttccaggctt
cttagacactgggtgactcatcctctatgcgatagaaatttgatatctgctcggcttgat
gctgtttctgagatttctgcttgcatgggatctcatagttcttcccagctcagcagtgag
ttggttgaagaaggttctgagagagcaattgtatcacctgagttttatctcgtgctctcc
tcagtcttgacagctatgtctagatcatctgatattcaacgtggaataacaagaatcttt
catcggactgctaaagccacagagttcattgcagttatggaagctattttacttgcgggg
aagcaaattcagcggcttggcataaagcaagactctgaaatgaggagtatgcaatctgca
actgtgcgatctactcttttgagaaaattgatttctgttatttcatcccctgttgtggtt
gacaatgccggaaaacttctctctgccctaaataaggaagcggctgttcgaggtgacttg
ctcgacatactaatcacttccagcgaccaatttcctgagcttgctgaagctcgccaagca
gttttagtcatcagggaaaagctggattcctcgatagcttcatttcgcaagaagctcgct
attcgaaatttggaatttcttcaagtgtcggggatcacacatttgatagagctgcccgtt
gattccaaggtccctatgaattgggtgaaagtaaatagcaccaagaagactattcgatat
catcccccagaaatagtagctggcttggatgagctagctctagcaactgaacatcttgcc
attgtgaaccgagcttcgtgggatagtttcctcaagagtttcagtagatactacacagat
tttaaggctgccgttcaagctcttgctgcactggactgtttgcactccctttcaactcta
tctagaaacaagaactatgtccgtcccgagtttgtggatgactgtgaaccagttgagata
aacatacagtctggtcgtcatcctgtactggagactatattacaagataacttcgtccca
aatgacacaattttgcatgcagaaggggaatattgccaaattatcaccggacctaacatg
ggaggaaagagctgctatatccgtcaagttgctttaatttccataatggctcaggttggt
tcctttgtaccagcgtcattcgccaagctgcacgtgcttgatggtgttttcactcggatg
ggtgcttcagacagtatccagcatggcagaagtacctttctagaagaattaagtgaagcg
tcacacataatcagaacctgttcttctcgttcgcttgttatattagatgagcttggaaga
ggcactagcacacacgacggtgtagccattgcctatgcaacattacagcatctcctagca
gaaaagagatgtttggttctttttgtcacgcattaccctgaaatagctgagatcagtaac
ggattcccaggttctgttgggacataccatgtctcgtatctgacattgcagaaggataaa
ggcagttatgatcatgatgatgtgacctacctatataagcttgtgcgtggtctttgcagc
aggagctttggttttaaggttgctcagcttgcccagatacctccatcatgtatacgtcga
gccatttcaatggctgcaaaattggaagctgaggtacgtgcaagagagagaaatacacgc
atgggagaaccagaaggacatgaagaaccgagaggcgcagaagaatctatttcggctcta
ggtgacttgtttgcagacctgaaatttgctctctctgaagaggacccttggaaagcattc
gagtttttaaagcatgcttggaagattgctggcaaaatcagactaaaaccaacttgttca
ttttga

DBGET integrated database retrieval system