KEGG   Arabidopsis thaliana (thale cress): AT4G35520
Entry
AT4G35520         CDS       T00041                                 
Symbol
MLH3
Name
(RefSeq) MUTL protein homolog 3
  KO
K08739  DNA mismatch repair protein MLH3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AT4G35520 (MLH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G35520 (MLH3)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     AT4G35520 (MLH3)
SSDB
Motif
Pfam: MutL_C HATPase_c_3 HATPase_c DUF6300
Other DBs
NCBI-GeneID: 829704
NCBI-ProteinID: NP_001320143
TAIR: AT4G35520
UniProt: F4JN26
Position
4:16865304..16871527
AA seq 1155 aa
MKTIKPLPEGVRHSMRSGIIMFDMARVVEELVFNSLDAGATKVSIFVGVVSCSVKVVDDG
SGVSRDDLVLLGERYATSKFHDFTNVETASETFGFRGEALASISDISLLEVRTKAIGRPN
GYRKVMKGSKCLHLGIDDDRKDSGTTVTVRDLFYSQPVRRKYMQSSPKKVLESIKKCVFR
IALVHSNVSFSVLDIESDEELFQTNPSSSAFSLLMRDAGTEAVNSLCKVNVTDGMLNVSG
FECADDWKPTDGQQTGRRNRLQSNPGYILCIACPRRLYEFSFEPSKTHVEFKKWGPVLAF
IERITLANWKKDRILELFDGGADILAKGDRQDLIDDKIRLQNGSLFSILHFLDADWPEAM
EPAKKKLKRSNDHAPCSSLLFPSADFKQDGDYFSPRKDVWSPECEVELKIQNPKEQGTVA
GFESRTDSLLQSRDIEMQTNEDFPQVTDLLETSLVADSKCRKQFLTRCQITTPVNINHDF
MKDSDVLNFQFQGLKDELDVSNCIGKHLLRGCSSRVSLTFHEPKLSHVEGYESVVPMIPN
EKQSSPRVLETREGGSYCDVYSDKTPDCSLGSSWQDTDWFTPQCSSDRGCVGIGEDFNIT
PIDTAEFDSYDEKVGSKKYLSSVNVGSSVTGSFCLSSEWSPMYSTPSATKWESEYQKGCR
ILEQSLRLGRMPDPEFCFSAANNIKFDHEVIPEMDCCETGTDSFTAIQNCTQLADKICKS
SWGHADDVRIDQYSIRKEKFSYMDGTQNNAGKQRSKRSRSAPPFYREKKRFISLSCKSDT
KPKNSDPSEPDDLECLTQPCNASQMHLKCSILDDVSYDHIQETEKRLSSASDLKASAGCR
TVHSETQDEDVHEDFSSEEFLDPIKSTTKWRHNCAVSQVPKESHELHGQDGVFDISSGLL
HLRSDESLVPESINRHSLEDAKVLQQVDKKYIPIVACGTVAIVDQHAADERIRLEELRTK
VLAGKARTVTYLSADQELVLPEMGYQLLQSYSEQIRDWGWICNITVEGSTSFKKNMSIIQ
RKPTPITLNAVPCILGVNLSDVDLLEFLQQLADTDGSSTIPPSVLRVLNSKACRGAIMFG
DSLLPSECSLIIDGLKQTSLCFQCAHGRPTTVPLVDLKALHKQIAKLSGRQVWHGLQRRE
ITLDRAKSRLDNAKS
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgaagacgatcaagcccttgccggaaggagttcgtcactccatgcgttctggaattatc
atgttcgacatggcgagggtcgtggaagaactcgtcttcaacagtctcgatgctggggcg
accaaggtgtctatcttcgtgggtgttgtttcatgctctgtgaaagttgtggatgatgga
tcaggcgtttcaagagatgatttggttttgttgggagaaagatatgctacttcaaagttt
cacgacttcaccaacgtggagacagctagtgaaacttttggatttcgtggagaggcctta
gcttcaatatcagatatctcgttactggaggttaggacaaaagctattgggaggcctaat
ggttatcgaaaggttatgaagggatccaagtgtctacatcttggaattgatgatgataga
aaagactctggcacgacggtaactgtccgagatctattttacagtcagccagtgagacga
aaatatatgcaatccagccccaagaaagttttggaatctatcaaaaagtgtgtgttccgg
attgcccttgtgcactccaatgtttccttcagtgttcttgatatcgaaagtgatgaagag
cttttccaaaccaatccttcttcttcagcattctcactactgatgagagatgcagggacc
gaagctgtaaattcgctttgtaaagtaaacgttacagatggcatgctgaatgtctctggt
tttgagtgtgcggatgactggaagcctacggatgggcaacaaacaggaagacgcaataga
cttcaatccaaccctggttacattctgtgcatagcatgtccacgccgtctttatgaattc
tcgtttgaaccatcaaagacgcacgttgagttcaagaagtggggacctgtacttgccttt
atagaaagaatcactctagccaactggaagaaagatagaattcttgaactttttgatggg
ggagctgatatactggcaaaaggtgatagacaagacctgattgatgacaaaattagactt
caaaacggcagccttttctcaattcttcattttctggatgcagattggccagaagctatg
gaacctgcaaaaaagaagctgaagagaagtaatgatcatgcaccttgtagttctctcttg
tttccgtctgctgactttaaacaagatggtgattatttttctccacgaaaggatgtatgg
tctccagaatgtgaagtcgaactgaaaattcagaatcccaaagagcaaggtactgtagct
ggatttgaaagccggactgattctcttctacagtcacgtgacatagaaatgcaaacgaat
gaagacttcccacaagttactgacctccttgaaacaagcttggttgctgactctaagtgc
cgtaaacagtttctaacaagatgtcagattaccacacctgtcaatatcaaccatgatttt
atgaaagattcagacgtgttaaattttcagtttcaaggattgaaagatgagttggatgtc
agcaattgcattggaaagcatctcttgcgtggttgctcttcaagagtaagcctaaccttt
catgagcctaaactatctcatgttgaagggtatgaatccgtcgtgcctatgatacctaat
gaaaaacaaagtagtccgcgggtcctagagaccagagaaggtggttcgtactgtgatgtt
tattctgataagactcctgattgttccctagggagttcatggcaggatactgattggttt
actccacagtgttcctcagataggggatgtgttggaattggagaagattttaacattacc
cccatagatactgcggaatttgattcttatgatgaaaaagttggtagtaaaaagtatctt
tcttctgtcaatgtggggagctctgttactggtagtttctgtttaagttctgagtggtct
ccaatgtactccacaccttctgcgaccaagtgggagtctgagtaccagaaaggttgtcga
attcttgaacagagtttgagactgggaaggatgcctgaccctgaattttgtttcagtgca
gctaacaacatcaaatttgaccacgaggtcatacctgaaatggattgctgtgaaaccggt
acagactctttcacagctattcagaactgcactcagttagctgataaaatttgcaagtct
tcgtgggggcatgcagatgatgtgcgtattgaccaatatagtatcaggaaggaaaagttc
agttatatggatggcacacagaacaatgctggtaaacaaaggtcaaaaagaagtcgatct
gctcctccattttatcgagagaagaagagatttatcagcttaagttgtaaatcagacaca
aaaccaaagaactctgatccatcagaacctgatgatctggagtgtttgacacaaccttgt
aatgcatctcaaatgcatcttaagtgcagcatccttgatgatgtgtcgtatgaccacata
caagaaacagaaaaaagattgagttctgcctcagacttgaaagcatctgctggttgcagg
actgtgcactcagagacccaagatgaggatgtgcacgaagacttcagctcagaggaattt
ctggatccaattaaatccacaacaaaatggcgccataactgtgcggtctctcaggttccc
aaggaatcacacgagcttcatggtcaagatggtgtatttgatatatcttcgggacttctg
cacttacgatccgatgaatccttggttcctgaatctatcaacagacactcccttgaagat
gccaaggttctacaacaggttgataaaaaatatatcccaatcgttgcttgtggaacagtt
gccatcgttgatcagcatgctgccgatgaaagaattcgtttggaagagctgcgtacaaag
gtcctggcagggaaagcgaggacagtcacctacttgagtgcagaccaagagttggtactg
ccggagatgggttatcagttactccagagttattcagagcagataagagactggggttgg
atctgcaacattactgtagaagggtcaacgtcctttaagaaaaacatgagcatcatccag
cggaaaccaacaccaatcacacttaatgcggttccatgcattctgggtgtaaatctatca
gatgttgatctattagagtttcttcagcagcttgctgatactgacggatcatcaactatt
cctccatctgttcttcgagtcctaaattccaaagcctgtagaggtgcaattatgtttgga
gatagtctgttaccgtcagaatgctctttaatcattgatggactgaagcagacctcactt
tgtttccagtgtgctcatgggcgacctacaacagttcctcttgtcgatttgaaggcattg
cacaaacagatagcaaagctcagtggaagacaagtgtggcatggcttacaacgcagagaa
attacacttgatcgtgcaaaatcacgcttagacaacgctaaaagttaa

DBGET integrated database retrieval system