KEGG   Arabidopsis thaliana (thale cress): AT4G35800
Entry
AT4G35800         CDS       T00041                                 
Symbol
NRPB1
Name
(RefSeq) RNA polymerase II large subunit
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT4G35800 (NRPB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT4G35800 (NRPB1)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT4G35800 (NRPB1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT4G35800 (NRPB1)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     AT4G35800 (NRPB1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT4G35800 (NRPB1)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R
Other DBs
NCBI-GeneID: 829734
NCBI-ProteinID: NP_001329346
TAIR: AT4G35800
UniProt: P18616 A0A178UYS0
Position
4:complement(16960558..16968128)
AA seq 1839 aa
MDTRFPFSPAEVSKVRVVQFGILSPDEIRQMSVIHVEHSETTEKGKPKVGGLSDTRLGTI
DRKVKCETCMANMAECPGHFGYLELAKPMYHVGFMKTVLSIMRCVCFNCSKILADEEEHK
FKQAMKIKNPKNRLKKILDACKNKTKCDGGDDIDDVQSHSTDEPVKKSRGGCGAQQPKLT
IEGMKMIAEYKIQRKKNDEPDQLPEPAERKQTLGADRVLSVLKRISDADCQLLGFNPKFA
RPDWMILEVLPIPPPPVRPSVMMDATSRSEDDLTHQLAMIIRHNENLKRQEKNGAPAHII
SEFTQLLQFHIATYFDNELPGQPRATQKSGRPIKSICSRLKAKEGRIRGNLMGKRVDFSA
RTVITPDPTINIDELGVPWSIALNLTYPETVTPYNIERLKELVDYGPHPPPGKTGAKYII
RDDGQRLDLRYLKKSSDQHLELGYKVERHLQDGDFVLFNRQPSLHKMSIMGHRIRIMPYS
TFRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQANRPVMGIVQD
TLLGCRKITKRDTFIEKDVFMNTLMWWEDFDGKVPAPAILKPRPLWTGKQVFNLIIPKQI
NLLRYSAWHADTETGFITPGDTQVRIERGELLAGTLCKKTLGTSNGSLVHVIWEEVGPDA
ARKFLGHTQWLVNYWLLQNGFTIGIGDTIADSSTMEKINETISNAKTAVKDLIRQFQGKE
LDPEPGRTMRDTFENRVNQVLNKARDDAGSSAQKSLAETNNLKAMVTAGSKGSFINISQM
TACVGQQNVEGKRIPFGFDGRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGR
EGLIDTAVKTSETGYIQRRLVKAMEDIMVKYDGTVRNSLGDVIQFLYGEDGMDAVWIESQ
KLDSLKMKKSEFDRTFKYEIDDENWNPTYLSDEHLEDLKGIRELRDVFDAEYSKLETDRF
QLGTEIATNGDSTWPLPVNIKRHIWNAQKTFKIDLRKISDMHPVEIVDAVDKLQERLLVV
PGDDALSVEAQKNATLFFNILLRSTLASKRVLEEYKLSREAFEWVIGEIESRFLQSLVAP
GEMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKRIKTPSLSVYL
TPEASKSKEGAKTVQCALEYTTLRSVTQATEVWYDPDPMSTIIEEDFEFVRSYYEMPDED
VSPDKISPWLLRIELNREMMVDKKLSMADIAEKINLEFDDDLTCIFNDDNAQKLILRIRI
MNDEGPKGELQDESAEDDVFLKKIESNMLTEMALRGIPDINKVFIKQVRKSRFDEEGGFK
TSEEWMLDTEGVNLLAVMCHEDVDPKRTTSNHLIEIIEVLGIEAVRRALLDELRVVISFD
GSYVNYRHLAILCDTMTYRGHLMAITRHGINRNDTGPLMRCSFEETVDILLDAAAYAETD
CLRGVTENIMLGQLAPIGTGDCELYLNDEMLKNAIELQLPSYMDGLEFGMTPARSPVSGT
PYHEGMMSPNYLLSPNMRLSPMSDAQFSPYVGGMAFSPSSSPGYSPSSPGYSPTSPGYSP
TSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPT
SPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPSYGPTSPSYNPQSAKYSPSIAYS
PSNARLSPASPYSPTSPNYSPTSPSYSPTSPSYSPSSPTYSPSSPYSSGASPDYSPSAGY
SPTLPGYSPSSTGQYTPHEGDKKDKTGKKDASKDDKGNP
NT seq 5520 nt   +upstreamnt  +downstreamnt
atggatacgaggtttccgttctctccggccgaggtctctaaagtccgggtggtccagttt
ggcatactcagccccgatgagatcaggcaaatgtctgttatacatgttgagcatagtgag
acgaccgagaagggtaaacctaaggtgggaggattgagtgatacccgtcttggtacgatt
gatcggaaggtgaagtgtgagacatgtatggctaatatggctgagtgtccgggacatttt
ggctatcttgagctcgctaagccaatgtatcatgtcggttttatgaagacagtgttaagt
atcatgagatgtgtctgtttcaattgctccaagattttagctgatgaggaggagcataag
tttaagcaggctatgaagatcaagaatcctaagaataggcttaagaagattctggatgcc
tgcaaaaacaagaccaaatgtgatggtggtgatgacattgacgatgtccaaagccacagc
acggatgaaccagtaaaaaagagccgaggtggatgtggtgcacaacaaccaaaactgact
attgagggtatgaagatgattgcagaatacaaaattcaaaggaagaaaaatgatgagcca
gatcagcttcccgagcctgcagaaaggaaacagacacttggtgctgatagggttttgagt
gttttgaaaaggattagtgacgcggattgtcaactcctaggtttcaaccctaagtttgct
cgtcctgactggatgattcttgaagtccttcctattcctccaccccctgtcagaccatct
gtaatgatggacgccacttccaggagtgaggatgacttgacccatcagctagctatgatt
attcgacacaatgaaaacttgaaaaggcaggaaaaaaatggagcgccagctcatattata
tcagagtttacacaactcttgcagtttcatatagctacgtattttgataacgagttgcct
ggacagccaagggctactcagaaatcagggaggcctattaaatcaatatgtagtaggctg
aaggcaaaggaaggcagaatcaggggtaacttgatgggaaaacgtgttgatttctcggca
cgtactgttattactccagatccaacaataaatattgatgaacttggtgttccgtggagt
attgctctgaatctcacatacccagaaacagttactccctataacattgaaagattaaag
gagcttgttgattatggaccacatcctccacctgggaagactggagcgaaatatatcata
agagatgatggccaaagactagatcttcggtatcttaagaagagcagtgatcaacatttg
gaacttggatacaaggtggagcggcatttacaggatggtgattttgttctgtttaatcgt
caaccaagtctgcacaaaatgtctatcatgggtcacaggattaggattatgccatattcc
actttccgtctgaatttgtctgtcacgtctccgtacaatgctgattttgatggggatgag
atgaacatgcatgtaccacaatcattcgagaccagagccgaggtgttagagctgatgatg
gttcctaaatgtattgtctccccccaggcgaatcgtcctgtgatgggaattgtgcaggat
accctcttggggtgccgtaaaattacaaagagagatactttcatagagaaggatgtattc
atgaacacactgatgtggtgggaagacttcgatgggaaagttccggctcctgcaatcttg
aagcctcgtcctctttggactggcaaacaagtttttaatcttatcataccaaaacagata
aatctgttgaggtactctgcttggcacgcagatacagagactggatttataactccgggg
gatactcaagtgcgaattgaaagaggggaacttcttgccggaactctttgcaaaaagacc
cttggtacatctaatggaagtctcgtgcatgtcatttgggaagaggttggtcctgatgca
gctagaaaattcctcggtcatactcaatggcttgtcaattactggcttctgcagaatggt
tttaccatcggaattggtgacacaattgccgattcatcaacaatggagaaaattaatgaa
actatttccaatgcaaaaactgctgtgaaagatcttatccggcagttccagggaaaggaa
ttggaccctgagcctggccgaactatgagagatacatttgagaacagggttaaccaggtt
ttgaataaagctcgtgatgatgctggaagtagtgctcaaaagagtttagcagaaaccaat
aaccttaaggccatggtgacagcaggatccaaaggaagtttcatcaatatttctcaaatg
acagcgtgtgtcggtcagcaaaatgttgaagggaagcgaattccatttggatttgatggg
cggacattgccacatttcaccaaagatgattatggtcctgaaagtcgtggttttgttgag
aattcgtacctgcgtggcttgactcctcaagagttctttttccatgctatgggaggacga
gaaggtcttattgatactgctgtgaagacatcagaaactggatacattcagaggcgattg
gtaaaggctatggaggatattatggttaagtatgatgggacagtcagaaactctttgggt
gatgttattcaatttctctatggagaagatggtatggatgctgtatggatagaatcacag
aagctggattccttgaaaatgaagaaatcagagtttgataggacttttaagtatgagatt
gacgacgaaaactggaatcctacttacctaagtgatgaacatcttgaagacttgaagggg
attcgggagttgcgtgatgtattcgatgcggaatattcgaaacttgagactgacagattc
caactcgggacagaaattgcaacaaatggtgatagcacttggccattgcctgttaacatc
aagaggcatatctggaatgcgcagaagactttcaaaattgacttgcgcaaaatttcagat
atgcaccctgttgaaattgttgatgctgttgataaactacaggagaggctgttggttgtt
cctggtgatgatgcgttgagtgtggaagcacagaaaaacgcaacattgttctttaacatt
ttgcttcgcagcactcttgctagtaaaagagtgttggaagaatacaagctcagccgcgag
gcttttgagtgggtcattggtgagattgaatcaaggtttttacaatcgctagtggcccca
ggggaaatgatcggttgtgttgctgctcaatcaattggagaacctgctacgcagatgact
ctgaataccttccattatgctggtgtcagtgcaaagaacgttacgctcggagttcccagg
ttgcgtgaaattattaatgtagctaagaggatcaaaacaccatccctatcagtctatctc
actccggaagctagcaaatcaaaagagggggctaagactgttcagtgtgctttggagtat
actactctcaggagtgttactcaagctacggaagtctggtatgacccagatccaatgagt
acaataattgaagaggactttgaatttgtgaggtcctactatgaaatgccagatgaagat
gtttccccagataagatatctccgtggctacttcgtatagagttgaatcgcgagatgatg
gttgataagaaattgagtatggcggatattgcggagaagatcaaccttgagttcgatgat
gacctaacttgcatattcaatgatgataatgctcaaaaactgatccttcgaattcgcatt
atgaacgatgagggcccaaagggagagttgcaagatgaatcggctgaagatgatgttttc
ctcaaaaagattgagagcaacatgctgacagaaatggcactcagaggtattccagacatc
aacaaggtttttataaaacaggttagaaagagcaggtttgatgaggagggaggcttcaag
acatctgaggagtggatgttggatacagaaggtgtgaacctcttagctgtcatgtgtcac
gaagatgtggatccaaagaggacaacaagcaatcacttgattgaaattattgaagttctc
ggaattgaggcagttcgtcgtgctttgcttgatgaactccgtgttgtgatatcctttgat
ggttcttatgtgaattaccgtcatcttgccatcttgtgtgatactatgacctatcgcggt
catctgatggctatcactcgacacggtatcaatagaaatgacactgggcctctgatgaga
tgctcttttgaagaaacagttgatattctgctagatgctgcggcttatgctgagacagac
tgcttacggggtgttactgagaatataatgttgggtcaacttgcaccaattgggacagga
gattgtgagttgtatctgaatgatgagatgctgaagaatgcaattgaacttcagctccct
agctatatggatggtcttgaatttggaatgactcctgctcgttcaccagtgtcaggcact
ccttaccatgaaggcatgatgtctccaaactacctgttaagtccaaatatgcgtttatcc
ccaatgtcagatgcacagttttctccatatgttggtggaatggccttttcgccttcttct
tctccaggatatagtccatcatcgcctggatacagtcctacttctcccggttacagtcca
acttcgcctggatatagcccgacttctcccggttacagtccaacttcgcctacctacagt
cccagttctcctggctatagcccaacaagccctgcttattctcctacaagtccttcctat
tctcctacctctccgagctacagcccaacgtctccaagctatagcccaacgtcgccaagc
tacagcccgacatctccgagctacagtcctacttccccaagttacagcccgacttcgcct
gcttacagcccgacttcacctgcttacagcccaacttcaccagcatacagcccaacctct
ccttcttacagcccaacttcaccttcttacagcccaacatcgccttcttacagccctact
tcaccatcttacagcccaacatctccgtcttacagccctacttcacccgcatatagcccc
acatctcctggctacagccctacttcaccaagttacagtccaacatcaccaagctacggt
cctacgtctccaagctacaaccctcagtctgctaaatatagcccatctatagcttactct
cctagcaatgcaagactatcaccagctagcccctacagtcctacatctcccaactacagc
ccgacatctccatcatactcacccacatctccatcttattcaccttcaagtccaacatac
agtcccagcagcccatacagctcaggagcaagcccagactacagcccaagcgcaggctac
tcgccaacacttcccggttattcaccgtcatcaacgggtcagtataccccacatgagggc
gataaaaaggacaagactggaaaaaaagatgccagtaaggatgataaaggcaacccttga

DBGET integrated database retrieval system