KEGG   Arabidopsis thaliana (thale cress): AT5G09920
Entry
AT5G09920         CDS       T00041                                 
Symbol
NRPB4
Name
(RefSeq) RNA polymerase II, Rpb4, core protein
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G09920 (NRPB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G09920 (NRPB4)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G09920 (NRPB4)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     AT5G09920 (NRPB4)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT5G09920 (NRPB4)
SSDB
Motif
Pfam: RNA_pol_Rpb4
Other DBs
NCBI-GeneID: 830853
NCBI-ProteinID: NP_196554
TAIR: AT5G09920
UniProt: O48890 A0A178UIQ5
Position
5:3096183..3097837
AA seq 138 aa
MSGEEEENAAELKIGDEFLKAKCLMNCEVSLILEHKFEQLQQISEDPMNQVSQVFEKSLQ
YVKRFSRYKNPDAVRQVREILSRHQLTEFELCVLGNLCPETVEEAVAMVPSLKTKGRAHD
DEAIEKMLNDLSLVKRFE
NT seq 417 nt   +upstreamnt  +downstreamnt
atgtccggagaagaagaagagaacgccgccgaactcaagatcggagatgagtttttgaag
gcaaagtgcttaatgaactgtgaagtctctttgattcttgagcacaagtttgaacagctt
cagcaaatctcagaggatcctatgaatcaagtttctcaagtgtttgagaagtccttgcaa
tatgtgaagcgattcagccgctacaagaatccagatgctgttagacaagttcgagaaata
ctaagcagacatcaactcactgagtttgagctatgtgttcttggcaatctctgtcctgaa
actgttgaagaagcagtggcaatggttccttctcttaagacaaaaggaagagctcatgat
gatgaagctattgagaagatgctcaatgatctctcacttgtcaagagattcgagtag

DBGET integrated database retrieval system