KEGG   Arabidopsis thaliana (thale cress): AT5G12200
Entry
AT5G12200         CDS       T00041                                 
Symbol
PYD2
Name
(RefSeq) pyrimidine 2
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00240  Pyrimidine metabolism
ath00410  beta-Alanine metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
Module
ath_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT5G12200 (PYD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G12200 (PYD2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT5G12200 (PYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT5G12200 (PYD2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     AT5G12200 (PYD2)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT5G12200 (PYD2)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 Elong-fact-P_C PUA
Other DBs
NCBI-GeneID: 831093
NCBI-ProteinID: NP_568258
TAIR: AT5G12200
UniProt: Q9FMP3 A0A178UKD8
Position
5:complement(3941528..3944866)
AA seq 531 aa
MALDAFFFIVSLFLLFPSPSASESTTQFCSAGRENGVGSCGVSSTRILIKGGTVVNAHHQ
ELADVYVENGIIVAVQPNIKVGDEVTVLDATGKFVMPGGIDPHTHLAMEFMGTETIDDFF
SGQAAALAGGTTMHIDFVIPVNGNLVAGFEAYENKSRESCMDYGFHMAITKWDEGVSRDM
EMLVKEKGINSFKFFLAYKGSLMVTDDLLLEGLKRCKSLGALAMVHAENGDAVFEGQKRM
IELGITGPEGHALSRPPVLEGEATARAIRLARFINTPLYVVHVMSVDAMDEIAKARKSGQ
KVIGEPVVSGLILDDHWLWDPDFTIASKYVMSPPIRPVGHGKALQDALSTGILQLVGTDH
CTFNSTQKALGLDDFRRIPNGVNGLEERMHLIWDTMVESGQLSATDYVRITSTECARIFN
IYPRKGAILAGSDADIIILNPNSSYEISSKSHHSRSDTNVYEGRRGKGKVEVTIAGGRIV
WENEELKVVPRSGKYIEMPPFSYLFDGIEKSDANYLSSLRAPVKRVRTEAT
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggctctggatgcattcttcttcatcgtctctctatttcttctgtttccgtcaccatcc
gcgtcagaatccactactcagttttgtagtgcagggagagagaatggtgtgggatcttgt
ggggtttcatcgacgaggattttgattaaaggaggtactgttgtcaatgcacaccatcaa
gaacttgctgatgtttatgtggaaaatggtattattgtcgctgtgcagccaaacattaag
gttggggatgaagtcactgtcctcgatgctactggaaagtttgtcatgccaggaggaatt
gacccccacacgcacctcgccatggaatttatgggtaccgagactattgatgatttcttc
agtggtcaggcagcggcattagctggtggaacaactatgcatatagactttgttatacct
gtcaatgggaatctggtggctggttttgaagcctatgaaaacaaatctagagaatcttgt
atggattacggttttcatatggcaatcacaaagtgggatgaaggtgtttccagggacatg
gagatgttggtcaaggaaaagggtatcaactctttcaagtttttcctagcgtataaagga
tctcttatggtaactgatgacctactcctagaaggacttaaaagatgcaaatccctcggt
gccttggccatggttcatgctgaaaatggagatgcagtattcgaaggacagaaaagaatg
attgaactgggcattacaggtccagagggtcatgctctttcaaggcctcctgtgctcgag
ggagaggccactgctagagcaattcgtttggctcgttttattaacacgcctctctatgtt
gttcatgtgatgagtgttgatgcaatggacgagattgctaaagctcgaaaatcaggacag
aaggttattggagagcctgttgtgtctggattaatccttgatgatcattggctttgggat
cctgacttcacaattgcgtccaagtatgtcatgagtccacctatcagaccagtaggacat
gggaaagccctacaagatgccctttccacaggaatccttcagcttgtaggaactgatcac
tgcactttcaattctacacaaaaagctctaggacttgatgatttccgcagaatacctaat
ggtgttaatggccttgaggaacggatgcacttgatatgggacacgatggtggagtctggc
caactctcagctactgattatgttcgaataaccagcactgagtgtgctagaattttcaac
atatatccacggaaaggagctatccttgctggctcggatgcagatattatcatattgaat
ccaaactcaagctacgagattagctcaaagtctcatcattcaagatcagacacaaacgtc
tacgagggcagaagaggaaagggaaaagttgaagtgacaatagcaggaggacgaattgtg
tgggaaaacgaggaacttaaagttgttccaagaagtggcaagtatatagagatgcctcct
ttcagttaccttttcgatggtattgagaaatcagatgctaattatctatcttctcttcga
gctccagttaagcgtgtcagaactgaagctacgtaa

DBGET integrated database retrieval system