KEGG   Arabidopsis thaliana (thale cress): AT5G13700
Entry
AT5G13700         CDS       T00041                                 
Symbol
PAO1
Name
(RefSeq) polyamine oxidase 1
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath00410  beta-Alanine metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AT5G13700 (PAO1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G13700 (PAO1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     AT5G13700 (PAO1)
    1.5.3.16  spermine oxidase
     AT5G13700 (PAO1)
    1.5.3.-
     AT5G13700 (PAO1)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox_3 FAD_binding_3 Thi4 HI0933_like FAD_binding_2 NAD_binding_9 FAD_oxidored GIDA FMO-like Shikimate_DH AlaDh_PNT_C Pyr_redox
Other DBs
NCBI-GeneID: 831215
NCBI-ProteinID: NP_196874
TAIR: AT5G13700
UniProt: Q9FNA2 A0A5S9Y3V1
Position
5:complement(4420069..4423095)
AA seq 472 aa
MSTASVIIIGAGISGISAAKVLVENGVEDVLILEATDRIGGRIHKQNFGDVPVELGAGWI
AGVGGKESNPVWELASRFNLRTCFSDYTNARFNIYDRSGKIFPTGIASDSYKKAVDSAIL
KLKSLEAQCSGQVAEEAPSSPKTPIELAIDFILHDFEMAEVEPISTYVDFGEREFLVADE
RGYECLLYKMAEEFLVTSHGNILDYRLKLNQVVREVQQSRNGVVVKTEDGSVYEANYVIV
SASIGVLQSDLLSFQPLLPRWKTEAIQKCDVMVYTKIFLKFPQCFWPCGPGQEFFIYAHE
QRGYFTFWQHMENAYPGSNILVVTLTNEQSKRVEAQSDQETMKEAMSVLRDMFGATIPYA
TDILVPRWWNNRFQRGSYSNYPMISDNQLLQNIKAPVGRIFFTGEHTSEKFSGYVHGGYL
AGIDTSKSLLEEMKQSLLLQPLLAFTESLTLTHQKPNNSQIYTNVKFISGTS
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgtctaccgcctccgtcatcatcattggcgctggaatctccggaatatcggcggcgaag
gttctcgtcgagaacggagtagaagatgtattgatactggaagcgacggatcggatcgga
ggaagaatacataaacagaatttcggtgacgtgccggtggagcttggcgccggttggatt
gccggtgtcggtggtaaagagtctaatcccgtttgggaacttgcctcgcgttttaacctc
cgtacttgcttttccgattacaccaatgctcgtttcaatatctacgatcgaagtggtaaa
atcttcccgacgggaatcgcttctgactcgtataaaaaggcggttgactcggcgattctc
aagttaaagagccttgaagctcaatgttctggtcaagtagctgaagaagctccttcgtca
ccgaagacgccaatagaactagccattgactttatcttgcatgattttgagatggctgag
gtagagccaatatccacttatgtagactttggtgaaagagagttcttggttgctgatgaa
agaggttacgaatgtttactttataaaatggctgaggaatttctcgttacctcacatgga
aatatcttggactaccgcctcaaactaaaccaggtagttagggaggtgcaacagtctagg
aatggggtagtggtgaagacagaggatggttccgtatacgaagctaattatgtgatcgtg
tctgcgagtatcggtgttctccaatctgatcttctctccttccaaccccttttacccaga
tggaaaacagaagctatacaaaaatgtgatgtgatggtgtacaccaagatcttcctgaaa
ttccctcaatgtttctggccatgtggtcctggtcaagagtttttcatttatgcacacgaa
caacgcggctatttcaccttttggcagcacatggaaaatgcgtacccgggctctaacatt
ctggtggtgacgttgaccaacgaacaatcaaagcgcgttgaagctcaatcagaccaggag
acgatgaaagaggcaatgagtgttctcagggacatgtttggggccaccattccttacgca
accgatattcttgtccccaggtggtggaacaaccggtttcaacgcggtagctacagtaat
taccctatgatatctgataatcagcttctgcaaaatatcaaggccccagttggacggata
ttctttacaggagaacacacaagtgaaaagttcagtgggtatgtacatggaggatacctt
gcaggtattgacacaagtaaatctttgttggaagagatgaagcagagtttgttgttacaa
cctttattggccttcaccgagtctcttacactaacacatcagaagcctaataactctcaa
atttacacaaatgttaaatttatctcaggcacaagctag

DBGET integrated database retrieval system