KEGG   Arabidopsis thaliana (thale cress): AT5G23710
Entry
AT5G23710         CDS       T00041                                 
Name
(RefSeq) DNA binding / DNA-directed RNA polymerase
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G23710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G23710
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT5G23710
SSDB
Motif
Pfam: RNA_pol_Rpc34 MarR_2 Mnd1
Other DBs
NCBI-GeneID: 832436
NCBI-ProteinID: NP_197760
TAIR: AT5G23710
UniProt: A0A654G4B2 Q9LSZ5
Position
5:complement(7996338..7997505)
AA seq 230 aa
MSKRKRPDPKSSGGDLNEPHEKKLLDLIRINQGRGATMFELKREKTIPATIVTRLIASLR
KKNLIKEVANMNNKGVKHYLAMEFEPCSELTGGEWYTDGALDLSKIEDLKAKCVMILERH
RQRVVTLEVLCGYFVKEEKLSVDQTKEILKNLILDNLIMEVKSNGMNEFASTRIGEVCYR
LTGKKFGNGEPRAGAFASIPCGVCPHIAICSPDGVISPTTCVYFQKWLDF
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagtaaacgaaaacgtccggatccgaaatcatcgggaggtgatctaaacgagccacac
gagaagaagcttctggatctgattcgaataaaccaaggaagaggcgcaactatgttcgaa
ttgaaacgcgagaaaacgatcccagcaactatagttactcgattgatcgcttctctacgg
aagaagaatctcatcaaagaagtagcaaacatgaacaacaaaggtgtcaaacattatctt
gcaatggagtttgagccttgtagtgaacttactggtggtgaatggtacactgatggagct
cttgacctgtcgaaaatcgaagatttgaaagccaagtgtgtgatgattttggagaggcat
aggcagagggttgttactttggaggttttgtgtgggtattttgttaaagaggagaagctg
agtgttgatcagactaaggagatacttaagaacttgattttggataatttgatcatggag
gtgaagagtaatggaatgaatgagtttgcttctacgagaatcggagaagtttgctacagg
ttgaccgggaaaaagttcggtaatggcgaaccgagagctggagcttttgcttcgattcct
tgcggggtttgtccgcatatagcgatctgttcacctgatggtgttatctctcccactaca
tgtgtttattttcagaaatggttagacttttag

DBGET integrated database retrieval system