KEGG   Arabidopsis thaliana (thale cress): AT5G48840
Entry
AT5G48840         CDS       T00041                                 
Symbol
PANC
Name
(RefSeq) pantoate-beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00410  beta-Alanine metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G48840 (PANC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT5G48840 (PANC)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     AT5G48840 (PANC)
SSDB
Motif
Pfam: Pantoate_ligase DUF4525
Other DBs
NCBI-GeneID: 834942
NCBI-ProteinID: NP_199695
TAIR: AT5G48840
UniProt: Q9FKB3
Position
5:complement(19803502..19805356)
AA seq 310 aa
MEPEVIRDKDSMRKWSRAMRSQGKTIGLVPTMGYLHEGHLSLVRQSLALTDVTVVSIYVN
PGQFSPTEDLSTYPSDFSGDLTKLAALSGGKVVVFNPKNLYDYGGETKKINDGGGNGGRV
VSCVEEGGLGHETWIRVERLEKGFCGKSRPVFFRGVATIVTKLFNIVEPDVALFGKKDYQ
QWRIIQRMVRDLNFGIEIVGSDIAREKDGLAMSSRNVRLSDEERQRALSISRSLAMAKAS
VAEGKTNCAELKDMIIQQVVGSAGRVDYVEIVDQETLEGVEEIKSGVVICVAAWFGTVRL
IDNIEINVSL
NT seq 933 nt   +upstreamnt  +downstreamnt
atggaaccagaagtaatcagagacaaagactctatgagaaaatggtctcgagccatgaga
tcacaaggcaagaccattggtttagtaccaacaatgggttacctccacgaaggtcactta
tctctcgttcgtcaatcactagccctcactgacgtcaccgtcgtctcaatctacgtcaat
ccaggccaattctctcccactgaagacctctccacatacccatctgatttctccggcgat
ctcactaagctcgcggctctttccggtggtaaagtcgtcgtctttaacccaaaaaacctc
tatgattacggcggtgagacgaagaagataaacgacggtggtggtaatggtgggagggta
gtgagttgtgtggaggaaggtgggttagggcatgagacttggattagggttgagagattg
gagaaaggtttttgtgggaagagtaggcctgtgttctttagaggtgttgctactattgtt
actaagctttttaatattgttgagcctgatgttgctctgtttggtaagaaagattatcaa
caatggaggattatacagagaatggttcgagatcttaattttggtattgagattgtagga
tcagatatagctagagaaaaagatggacttgcgatgagttcgagaaatgtgcgtctttca
gatgaagaaaggcaaagggctttgtctataagtaggtcactggccatggctaaagcttct
gttgcagaagggaaaaccaattgtgcagagcttaaggatatgatcattcaacaagttgtt
ggatctgcaggacgagtagattatgtcgagatagttgaccaagaaactcttgaaggagta
gaagagataaagagtggggtagtgatttgtgttgctgcttggtttggaacggtcaggctc
atagacaacattgagatcaatgtctctctctag

DBGET integrated database retrieval system