KEGG   Arabidopsis thaliana (thale cress): AT5G49530
Entry
AT5G49530         CDS       T00041                                 
Name
(RefSeq) SIN-like family protein
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G49530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G49530
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     AT5G49530
SSDB
Motif
Pfam: RPC5 SpoIIID
Other DBs
NCBI-GeneID: 835014
NCBI-ProteinID: NP_199764
TAIR: AT5G49530
UniProt: A0A178UG18 Q9FGZ3
Position
5:20100545..20104605
AA seq 689 aa
MDFDDDDKPKEVTKTRRFAPGRAGKSKPKPKPEPTADKPVQPPPQSQTESVSKTEHDVDA
KFVGTKVETEVCNGSVKMEIDSKVDKEPEIMETELMEEDQQLPLQEEKEEEEEEDDVVVR
EIDVFFKPSIDANTQLYVLQYPLRPSWRPYEMDERCEEVRVNPSTSQVEIDLSMDVHSKN
YDSNFGLNMTKQTLKTTWKQPPTLDYAVGVLSGDKLHLNPVHAVAQLRPSMQSLSSDKKK
KQEESTEESVGTSKKQNKGVQQASTDQKPINEETWVSLKYHGLQSEYCSRYLNGMMANGN
SSIDFNMSPGTYINELCRGGSSRNSESKETLKRVLLSLPLKERVQKLLCEGSPLIRYSVL
KHYAPEFSDEDFLGALQEYGRLVQGLWTPKTRLLKLDGPVEAARDYVLSLFSQNTTIKYS
EVEATGDKMKPLMERMLTEFAKERHVLKDWKFKEPTDVSFIKSYPEIVKEQDIFWTDKRE
NLKSRITAQGGKSRADKRRNVVGTSSSVTVKPEVPTTLSDKGGSSKNTIHRVVTQEMPEE
LKKALPKALKKVFQTHKVCRYETICQGLRDLAVSTSNNPKADSGMAVNVALAVDAYQGEL
EDVINGVATNIHGSYVSISSPDHPEYDSLREVVISLLTGSPPGTKLMKAEVFAAGRTKLE
REITNNEYIKVMHEICETNSSGWVLQKAR
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggactttgatgatgatgacaaaccaaaagaggttaccaaaacccgtagattcgctcct
ggccgtgccggaaagtctaaacccaaacctaaaccggaacccactgctgataaaccggta
cagccgccgccgcagtcacaaactgagtccgtgagcaagactgagcatgacgttgatgct
aaattcgttggcactaaggttgaaactgaggtttgtaatggctctgtgaagatggagatc
gattcaaaagtcgataaagagcctgagatcatggaaactgagttgatggaggaagatcag
cagcttccattgcaggaggagaaggaggaagaagaagaagaagacgacgttgttgttcgt
gaaattgatgttttctttaagccgtctattgatgctaatactcagctttatgttttacaa
tatcctctaagaccatcttggcgtccatacgaaatggatgaacgttgcgaagaagttaga
gtgaatccttctacatcgcaagtggaaattgatttgtctatggatgttcattcgaagaac
tatgactccaattttggactaaatatgactaagcagaccttgaaaacaacatggaagcag
cctcctactttggattatgctgttggggttctttcaggtgataagttacacttgaatcct
gttcatgctgttgcccagctccggccgtctatgcagtctctttcatccgacaaaaaaaag
aaacaagaagaatccactgaagaatctgtgggaacatccaaaaagcagaacaagggagtg
cagcaggcttcgacggatcagaaaccaattaatgaagaaacttgggtttcactcaagtat
catggacttcaatccgaatattgctccagatatcttaacgggatgatggcgaatgggaac
tcttcgatagatttcaacatgagcccgggcacttatatcaacgaactatgccgtggggga
agcagcagaaactctgaatcgaaagaaacattaaaaagggtcttgctctccctaccactt
aaagaacgtgtgcaaaagttgctctgcgagggatctccgttgattcgatacagtgttctt
aaacactatgctcctgagttctcagacgaggatttcttaggggccctccaagaatatggc
aggttagttcaaggtttatggactcctaaaactaggctactaaaactagacgggcctgta
gaagctgccagggattatgtcctgtctctgttcagccagaatacaactataaagtactct
gaagttgaagcaacgggtgacaagatgaaacctttgatggaaagaatgttgactgaattt
gccaaagaaaggcatgtgctaaaagattggaagttcaaagagcccactgatgtctcattc
ataaaatcctacccggagattgttaaggagcaagatattttttggacggataagagagag
aatctaaagtcgagaataaccgcccaaggaggaaaaagtagagctgataaaaggaggaat
gttgttggcacaagttcttcagttacagttaaaccggaggttccaacaaccctctctgac
aaaggaggaagttcaaaaaatacgatacatcgtgttgttacacaagaaatgccagaagaa
cttaagaaggcgttaccaaaggctttgaaaaaggtgtttcaaactcacaaagtttgccgc
tatgagacgatctgccaaggacttagggatcttgcagtttcgacatcgaataatccaaaa
gctgattcaggaatggcggtgaatgtggcgctagccgtggatgcttaccagggcgagctc
gaagacgttataaatggagtggctactaacattcacgggtcttatgtctccatatcgtct
ccagaccatcctgaatatgattctttgagggaagtggtcattagcctcttaaccggatct
ccacctggaacaaagcttatgaaggctgaggtatttgcagcaggcaggaccaaacttgaa
cgtgaaatcaccaacaacgaatatataaaggtgatgcacgagatctgtgaaaccaactct
tcaggatgggttttacagaaagctcgatga

DBGET integrated database retrieval system