KEGG   Arabidopsis thaliana (thale cress): AT5G54160
Entry
AT5G54160         CDS       T00041                                 
Symbol
OMT1
Name
(RefSeq) O-methyltransferase 1
  KO
K13066  caffeic acid 3-O-methyltransferase / acetylserotonin O-methyltransferase [EC:2.1.1.68 2.1.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00380  Tryptophan metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AT5G54160 (OMT1)
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT5G54160 (OMT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.4  acetylserotonin O-methyltransferase
     AT5G54160 (OMT1)
    2.1.1.68  caffeate O-methyltransferase
     AT5G54160 (OMT1)
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation Methyltransf_PK Bin3
Other DBs
NCBI-GeneID: 835504
NCBI-ProteinID: NP_200227
TAIR: AT5G54160
UniProt: Q9FK25 A0A654GB27
Position
5:21981902..21984399
AA seq 363 aa
MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGSPMSPTEI
ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGV
SIAALCLMNQDKVLMESWYHLKDAILDGGIPFNKAYGMSAFEYHGTDPRFNKVFNNGMSN
HSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSH
PGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPE
TPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELL
KKL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgggttcaacggcagagacacaattaactccggtgcaagtcaccgacgacgaagctgcc
ctcttcgccatgcaactagccagtgcttccgttcttccgatggctttaaaatccgcctta
gagcttgaccttcttgagattatggccaagaatggttctcccatgtctcctaccgagatc
gcttctaaacttccgaccaaaaatcctgaagctccggtcatgctcgaccgtatcctccgt
cttcttacgtcttactccgtcttaacctgctccaaccgtaaactttccggtgatggcgtt
gaacggatttacgggcttggtccggtttgcaagtatttgaccaagaacgaagatggtgtt
tccattgctgctctttgtcttatgaaccaagacaaggttctcatggaaagctggtaccat
ttgaaggatgcaattcttgatggtgggattccattcaacaaggcttatggaatgagcgcg
ttcgagtaccacgggactgaccctagattcaacaaggtctttaacaatggaatgtctaac
cattccacaatcaccatgaagaagattcttgagacctataagggttttgaaggattgact
tctttggttgatgttggtggtggcattggtgctacactcaaaatgattgtctccaagtac
cctaatcttaaaggcatcaactttgatctcccacatgtcatcgaagatgctccttctcat
cctggtattgagcatgttggaggagatatgtttgtaagtgtccctaaaggtgatgccata
ttcatgaagtggatatgtcatgactggagtgacgaacattgcgtgaaattcttgaagaac
tgctacgagtcacttccagaggatggaaaagtgatattagcagagtgtatacttccagag
acaccagactcaagcctctcaaccaaacaagtagtccatgtcgattgcattatgttggct
cacaatcccggaggcaaagaacgaaccgagaaagagtttgaggcattagccaaagcatca
ggcttcaagggcatcaaagttgtctgcgacgcttttggtgttaaccttattgagttactc
aagaagctctaa

DBGET integrated database retrieval system