KEGG   Arabidopsis thaliana (thale cress): AT5G59180
Entry
AT5G59180         CDS       T00041                                 
Symbol
NRPB7
Name
(RefSeq) DNA-directed RNA polymerase II
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G59180 (NRPB7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G59180 (NRPB7)
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT5G59180 (NRPB7)
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT5G59180 (NRPB7)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     AT5G59180 (NRPB7)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     AT5G59180 (NRPB7)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      AT5G59180 (NRPB7)
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 836036
NCBI-ProteinID: NP_200726
TAIR: AT5G59180
UniProt: P38421 A0A178UBZ0
Position
5:23883356..23885305
AA seq 176 aa
MFFHIVLERNMQLHPRFFGRNLKENLVSKLMKDVEGTCSGRHGFVVAITGIDTIGKGLIR
DGTGFVTFPVKYQCVVFRPFKGEILEAVVTLVNKMGFFAEAGPVQIFVSKHLIPDDMEFQ
AGDMPNYTTSDGSVKIQKECEVRLKIIGTRVDATAIFCVGTIKDDFLGVINDPAAA
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtttttccacatagtattggagcggaacatgcagttgcatcctcgtttctttggtcgt
aacctaaaagaaaacctcgtatctaagctcatgaaagatgtcgaaggcacttgcagtggc
cgacatggatttgtagtggcgataactggaatagatacaataggaaagggtttgatcaga
gatgggactggttttgtcacctttccagttaaataccaatgcgtcgttttcagacctttc
aaaggcgagattttggaagctgttgtcactttggtcaataagatgggattcttcgctgaa
gctggccctgttcagatttttgtgtctaagcatttgattccagatgatatggagtttcaa
gctggagacatgcctaactataccacatcagatggatcagttaagatccagaaggagtgt
gaagtgagactaaagattattggaacaagagttgatgccactgcgattttttgtgtgggt
accatcaaagacgattttttgggagtcataaacgaccctgcagcggcataa

DBGET integrated database retrieval system