KEGG   Arabidopsis thaliana (thale cress): AT5G60040
Entry
AT5G60040         CDS       T00041                                 
Symbol
NRPC1
Name
(RefSeq) nuclear RNA polymerase C1
  KO
K03018  DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AT5G60040 (NRPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT5G60040 (NRPC1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AT5G60040 (NRPC1)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     AT5G60040 (NRPC1)
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_1 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 836126
NCBI-ProteinID: NP_200812
TAIR: AT5G60040
UniProt: F4JXF9 A0A5S9YGT2
Position
5:24173259..24183641
AA seq 1376 aa
METKMEIEFTKKPYIEDVGPLKIKSINFSVLSDLEVMKAAEVQVWNIGLYDHSFKPYENG
LLDPRMGPPNKKSICTTCEGNFQNCPGHYGYLKLDLPVYNVGYFNFILDILKCICKRCSN
MLLDEKLYEDHLRKMRNPRMEPLKKTELAKAVVKKCSTMASQRIITCKKCGYLNGMVKKI
AAQFGIGISHDRSKIHGGEIDECKSAISHTKQSTAAINPLTYVLDPNLVLGLFKRMSDKD
CELLYIAYRPENLIITCMLVPPLSIRPSVMIGGIQSNENDLTARLKQIILGNASLHKILS
QPTSSPKNMQVWDTVQIEVARYINSEVRGCQNQPEEHPLSGILQRLKGKGGRFRANLSGK
RVEFTGRTVISPDPNLKITEVGIPILMAQILTFPECVSRHNIEKLRQCVRNGPNKYPGAR
NVRYPDGSSRTLVGDYRKRIADELAIGCIVDRHLQEGDVVLFNRQPSLHRMSIMCHRARI
MPWRTLRFNESVCNPYNADFDGDEMNMHVPQTEEARTEAITLMGVQNNLCTPKNGEILVA
STQDFLTSSFLITRKDTFYDRAAFSLICSYMGDGMDSIDLPTPTILKPIELWTGKQIFSV
LLRPNASIRVYVTLNVKEKNFKKGEHGFDETMCINDGWVYFRNSELISGQLGKATLGNGN
KDGLYSILLRDYNSHAAAVCMNRLAKLSARWIGIHGFSIGIDDVQPGEELSKERKDSIQF
GYDQCHRKIEEFNRGNLQLKAGLDGAKSLEAEITGILNTIREATGKACMSGLHWRNSPLI
MSQCGSKGSPINISQMVACVGQQTVNGHRAPDGFIDRSLPHFPRMSKSPAAKGFVANSFY
SGLTATEFFFHTMGGREGLVDTAVKTASTGYMSRRLMKALEDLLVHYDNTVRNASGCILQ
FTYGDDGMDPALMEGKDGAPLNFNRLFLKVQATCPPRSHHTYLSSEELSQKFEEELVRHD
KSRVCTDAFVKSLREFVSLLGVKSASPPQVLYKASGVTDKQLEVFVKICVFRYREKKIEA
GTAIGTIGAQSIGEPGTQMTLKTFHFAGVASMNITQGVPRINEIINASKNISTPVISAEL
ENPLELTSARWVKGRIEKTTLGQVAESIEVLMTSTSASVRIILDNKIIEEACLSITPWSV
KNSILKTPRIKLNDNDIRVLDTGLDITPVVDKSRAHFNLHNLKNVLPNIIVNGIKTVERV
VVAEDMDKSKQIDGKTKWKLFVEGTNLLAVMGTPGINGRTTTSNNVVEVSKTLGIEAART
TIIDEIGTVMGNHGMSIDIRHMMLLADVMTYRGEVLGIQRTGIQKMDKSVLMQASFERTG
DHLFSAAASGKVDNIEGVTECVIMGIPMKLGTGILKVLQRTDDLPKLKYGPDPIIS
NT seq 4131 nt   +upstreamnt  +downstreamnt
atggagacgaagatggaaattgaattcactaagaagccctacatcgaagatgttggtcct
cttaaaataaaaagcataaacttctctgtgctttctgatcttgaggtcatgaaagccgct
gaagttcaagtctggaacatcggtttatacgaccacagttttaaaccctatgaaaacggc
ttgttggatcctcgaatgggtcctccaaacaaaaagtctatatgcacaacctgtgaagga
aacttccaaaattgtccgggacactatggatatctgaagcttgacctcccagtttacaac
gttggatactttaattttatccttgatattttgaagtgcatttgtaagcgctgttccaac
atgcttttagatgagaaattgtatgaagatcacttgaggaagatgcggaatcccagaatg
gagccattgaagaagacagaattggcaaaagccgttgtcaagaagtgcagtacgatggcg
agccagagaattataacgtgcaaaaaatgtggctacctgaatgggatggtaaaaaagatt
gcagcgcagtttggtataggcatcagtcatgaccgatctaaaatccatggtggagagatt
gatgaatgtaaatctgcaatatcccacacaaagcagtctactgcagcaataaatcctctt
acctatgttcttgatcctaacttggtgctcgggctttttaaaagaatgagtgacaaggac
tgcgaacttctttatattgcctatagacctgagaatcttatcataacgtgcatgcttgtg
ccacctttatccatccgaccgtctgttatgattggtggtattcaaagcaatgaaaacgac
ttaacagcgcgattaaagcaaatcattctaggcaatgcttctcttcataaaattttaagt
caacctacctcatcccccaaaaacatgcaagtatgggatacagttcaaatcgaggttgca
agatacattaacagtgaagtccgtggttgtcaaaaccagccagaagagcatccactgtct
ggaattcttcagcgtctcaaaggaaaagggggacgtttccgtgcaaacttgtcggggaag
cgtgtcgagttcactggtagaactgtaatttcacctgatcccaatctgaaaattacagag
gtaggaattccaatccttatggctcagatcctaacttttcctgaatgtgtttctcgtcat
aatattgagaagttgaggcaatgtgtccgtaatggccctaataaataccctggtgccaga
aatgtcagatatccagatggttcttcaaggactttggttggtgattatcgcaagcgtatt
gctgatgaactggccattggctgcatagttgaccgccatttgcaagaaggagatgttgtt
ctttttaacaggcaaccgagtctgcatcggatgtctatcatgtgtcacagggcaagaata
atgccttggagaacgttgaggttcaacgaatcggtttgtaacccatataatgctgatttt
gatggtgatgagatgaacatgcacgtaccacaaacagaggaggctcggacagaggctatt
acattgatgggggtacaaaacaatttatgcaccccaaaaaatggagaaattttagtagca
tcaacgcaggactttttgacatcttcttttttgataacgagaaaggacacattttatgac
cgtgcagccttttcacttatatgttcttacatgggagatgggatggattccatagatttg
ccaacacccacaatccttaagccaatagagctttggactggtaaacagatctttagtgtt
ttgctgcgtccaaatgcaagtattagagtctacgtaactcttaatgtgaaagagaagaac
ttcaagaagggagagcatggtttcgatgaaacaatgtgcataaatgatggatgggtttat
tttcgaaacagtgagctaatatcaggacagttggggaaggctacgttaggaaatggaaac
aaggatggattatattctattcttctaagagattacaactcccatgctgctgcagtctgc
atgaatcggctagcaaaattgagtgctcggtggattggtatccatggcttctctattgga
attgatgacgttcaacctggtgaagagttgagtaaggaaagaaaagacagcatccagttt
ggatatgaccagtgccatcgcaaaattgaggaatttaatagaggaaatttgcaacttaaa
gctggtctagatggtgcaaaatccttagaagctgaaataacagggattctcaatacaatt
cgagaagccactgggaaggcctgtatgagcggattacattggagaaatagtcccttgatc
atgtcacaatgtggttccaaaggatctcctatcaatatcagtcagatggtcgcatgtgtt
ggtcagcagacagttaatggtcaccgtgctcctgatggatttatagatcgaagtcttcct
catttccctaggatgtccaaatcacctgcagcgaaaggttttgttgctaattcgttctac
agtggtcttactgccacagaatttttctttcacactatgggtggacgagaaggtctagtt
gatacagcggtgaaaactgcaagtacaggttacatgtctcgtagactgatgaaagccttg
gaggatctattagtccattatgataacacagtgagaaatgccagcggatgtatacttcaa
tttacttatggggatgatggaatggacccagcactaatggaaggaaaggatggagctcct
ttaaattttaatagattatttctgaaagttcaggccacatgtcctcctcgatctcaccac
acatatctttcttcagaagaattgtcgcaaaagtttgaagaggaattagtcagacatgat
aaaagtcgggtttgcactgatgcctttgtgaaatctcttcgagaatttgtttccttgctc
ggagtgaagtctgcaagcccgccccaggttttatataaagcatctggtgtgactgataag
caactcgaggtatttgtaaaaatttgtgtatttcgctaccgggaaaaaaaaattgaggct
gggactgcaattgggacaataggagctcagagtattggagaacctgggacacaaatgact
ttgaaaacttttcactttgctggagttgcgagcatgaatatcacacaaggagtcccccga
atcaatgaaatcatcaatgcttccaaaaatataagcacgcctgtcatctctgcagaactt
gagaaccccctggaattgactagtgcacgatgggtgaaaggacgcattgagaaaactact
ttaggacaggttgctgagagtatcgaggtgctaatgacttcaacatcagcgtcagtgagg
ataattcttgacaataaaataatcgaggaggcatgtttatctataaccccctggtcggta
aaaaattccatcctaaagacccccagaatcaaactcaacgataatgatattagggtttta
gatacgggtttggatattactcccgtggtggataaaagtagggctcatttcaatctccac
aatctgaagaatgtgctgccaaatattatagtgaatgggatcaaaacagttgagcgagtt
gttgtcgcagaggatatggataaaagtaaacagatagatgggaagacaaagtggaaactg
tttgtggagggcacaaacctcctggcagttatggggacaccgggaatcaatgggagaact
actacaagtaacaatgttgtcgaagtaagcaaaacacttggaatcgaggctgcaaggaca
acgattattgatgaaatagggacagttatgggaaaccatggtatgagtatagacatccgt
cacatgatgcttttggctgatgtcatgacttacaggggggaggttctcggaatacaaaga
accgggattcagaagatggataaaagtgttctgatgcaggcatcttttgagaggactgga
gatcatttatttagtgcagcagctagcggaaaagttgataacatagagggagttacagaa
tgtgtgattatgggcataccaatgaagctcggaaccgggatactcaaagtccttcaaagg
accgatgatttgcccaagttgaaatatggacctgatccaatcatctcttga

DBGET integrated database retrieval system