KEGG   Arabidopsis thaliana (thale cress): AT5G61160
Entry
AT5G61160         CDS       T00041                                 

Symbol
AACT1
Name
(RefSeq) anthocyanin 5-aromatic acyltransferase 1
  KO
K14329  agmatine coumaroyltransferase [EC:2.3.1.64 2.3.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00330  Arginine and proline metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AT5G61160 (AACT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.64  agmatine N4-coumaroyltransferase
     AT5G61160 (AACT1)
    2.3.1.-  
     AT5G61160 (AACT1)
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 836237
NCBI-ProteinID: NP_200924
TAIR: AT5G61160
UniProt: Q9FNP9 A0A654GE24
Position
5:24608781..24610139
AA seq 452 aa
MALKVIKISRVSPATASVDPLIVPLSFFDLQWLKLNPTEQVFFYKLTESSSSRDVFYSSI
LPKLERSLSLILTHFRLFTGHLKWDSQDPKPHLVVLSGDTLSLTVAETDADFSRISGRGL
RPELELRPLIPELPIYSDSGAVVSLQVTLFPKQGFCIGTTAHHVVLDGKTAEKFNKAWAH
TCKHGTIPKILPTVLDRSVVNVPAGLEQKMLELLPYLTEDDKENGRTLKLPPVKEINAKD
NVLRITIEISPENIEKLKERAKKESTRAELHLSTFVVTFAHVWTCMVKARSGDPNRPVRF
MYAADFRNRLEPPVPVTYFGTCVLAMDFYKYKAKEFMGEDGFVNTVEILSDSVKRLASQG
VESTWKVYEEGTKTMKWGTQLLVVNGSNQIGMYETDFGWGRPIHTETMSIYKNDEFSMSK
RRDGIGGVEIGISLKKLEMDTFLSLFYKWIGN
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcgttaaaggtgatcaagatctcccgagtcagccctgcaaccgcctccgtcgacccg
ctcattgtcccactctcgttctttgatttacagtggcttaaactcaaccctaccgagcaa
gtcttcttttacaaactcaccgaatcatcatcatctcgcgacgttttctactcctccatc
ctccccaagctcgagcgatctctttcactcatcctcactcactttcgcctattcacgggt
caccttaagtgggattcacaagatccaaagccgcatttagttgttctctcaggagacaca
ctctctctcacagtggctgagactgatgcggatttctcacgtatctctggcagagggctt
cgtccagagctagagttacgccctctaatacccgagctaccgatttattctgactcgggg
gctgttgtatctctgcaagtcactttgttcccgaaacaaggcttctgcattggaaccaca
gcccaccatgtcgtcttggacggcaaaacggctgaaaaatttaacaaagcatgggctcac
acttgtaaacatggcaccataccgaaaattctaccaacggttttagatcgttctgtcgtc
aatgttccagccggacttgaacaaaagatgctcgaacttctgccgtatcttacggaggac
gacaaagagaacggaagaaccctaaagctacctccagtcaaagagattaacgctaaagac
aacgtcctccgaatcaccatcgagataagtcctgaaaacattgagaaactcaaggagaga
gccaagaaagagtcaacacgcgctgagcttcacttgtcaacgttcgtagtcacgttcgcc
catgtgtggacatgcatggtgaaggcacgtagtggtgacccaaaccgaccggttcgtttc
atgtacgctgctgattttaggaaccggttagaaccaccagtccctgtgacatacttcggg
acttgtgtcttagccatggatttctataaatacaaagctaaggagtttatgggagaagat
ggatttgtcaacaccgtcgagattctcagtgattcggtcaaacgtttggcttcacaaggg
gtagagtcaacttggaaagtgtatgaggaaggaacaaagacaatgaaatggggtacacag
ttgttggtcgtaaacgggtcgaaccagattgggatgtacgaaacggacttcgggtgggga
agacccattcacactgagacaatgtctatctacaagaacgatgagttctctatgtccaag
aggagagatggtatcggtggcgtcgagattggcatctctttgaagaaacttgagatggat
acttttctgtctttattttacaaatggattggaaactga

DBGET integrated database retrieval system