KEGG   Arabidopsis thaliana (thale cress): AT5G64370
Entry
AT5G64370         CDS       T00041                                 
Symbol
BETA-UP
Name
(RefSeq) beta-ureidopropionase
  KO
K01431  beta-ureidopropionase [EC:3.5.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00240  Pyrimidine metabolism
ath00410  beta-Alanine metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
Module
ath_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT5G64370 (BETA-UP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G64370 (BETA-UP)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT5G64370 (BETA-UP)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     AT5G64370 (BETA-UP)
SSDB
Motif
Pfam: CN_hydrolase DUF2861
Other DBs
NCBI-GeneID: 836558
NCBI-ProteinID: NP_201242
TAIR: AT5G64370
UniProt: Q8H183 A0A178UGH6
Position
5:25739131..25741222
AA seq 408 aa
MDHMISENGETSAEGSICGYDSLHQLLSANLKPELYQEVNRLLLGRNCGRSLEQIVLPES
AKALSSKHDFDLQAASFSADKEQMRNPRVVRVGLIQNSIALPTTAPFSDQTRGIFDKLKP
IIDAAGVAGVNILCLQEAWTMPFAFCTRERRWCEFAEPVDGESTKFLQELAKKYNMVIVS
PILERDIDHGEVLWNTAVIIGNNGNIIGKHRKNHIPRVGDFNESTYYMEGDTGHPVFETV
FGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVG
SINRVGTEVFPNPFTSGDGKPQHNDFGHFYGSSHFSAPDASCTPSLSRYKDGLLISDMDL
NLCRQYKDKWGFRMTARYEVYADLLAKYIKPDFKPQVVSDPLLHKNST
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggatcatatgatatcagaaaacggagaaacaagtgccgaaggatcgatttgcggctat
gattcgctgcatcaactcttatcagcgaatcttaagcccgagctctatcaggaggtaaac
cggttgctccttggacgtaactgtgggagatcgcttgaacagattgttctgccggagtct
gctaaagccttgtcttcaaaacatgattttgatctccaggctgctagcttttcagctgat
aaagagcaaatgagaaatcctcgagtggtcagagttggtctcattcaaaactccattgct
cttccaaccactgctccattctcggaccaaacaagaggaatattcgacaagttgaagccg
ataatcgatgctgcgggtgttgctggtgttaacatactgtgcttgcaggaagcttggacc
atgccatttgcattttgcactagggagaggagatggtgtgagtttgcagagcctgttgat
ggcgaatcgacaaagtttcttcaagaactcgctaaaaagtataacatggtgattgttagt
cctattctcgaaagagatattgatcacggtgaagtgctttggaataccgctgtgattata
gggaataatggaaatatcattggcaagcatcgaaagaaccatatacctagggtaggagat
ttcaacgagagcacctattacatggaaggagacacaggccatcctgtgtttgagacggtg
tttgggaaaattgcggttaatatatgttatggcagacaccatcctctgaattggttagct
tttggtctaaatggtgcagagattgtcttcaacccttcagcaactgttggtgaactcagt
gaaccaatgtggcctattgaggcacgaaatgccgcaatagcaaacagttactttgttgga
tccattaaccgagttggaaccgaagtattccccaatccttttacgtcaggtgatggaaaa
ccgcaacacaatgatttcgggcatttctatgggtcaagccatttttctgcaccagatgct
tcttgcacaccgtctttgtcccgttacaaagatggtttattgatctcggacatggatctc
aatctctgccggcaatacaaggacaagtggggatttagaatgactgcaagatacgaagtc
tatgccgatcttttggcaaagtacataaagccagacttcaagcctcaagtcgtctctgac
ccattgctccacaagaattctacataa

DBGET integrated database retrieval system