KEGG   Arabidopsis thaliana (thale cress): ArthCp012
Entry
ArthCp012         CDS       T00041                                 
Symbol
rpoC2
Name
(RefSeq) RNA polymerase beta'' subunit
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    ArthCp012 (rpoC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    ArthCp012 (rpoC2)
   03400 DNA repair and recombination proteins [BR:ath03400]
    ArthCp012 (rpoC2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     ArthCp012 (rpoC2)
Transcription machinery [BR:ath03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     ArthCp012 (rpoC2)
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      ArthCp012 (rpoC2)
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_4 RNA_pol_Rpb1_3 Peptidase_M23
Other DBs
NCBI-GeneID: 844785
NCBI-ProteinID: NP_051049
TAIR: ATCG00170
UniProt: P56764
Position
CP:complement(15938..20068)
AA seq 1376 aa
MAERANLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGID
DLLTIPSKGWLVQDAEQQSWILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFR
MTDPFNPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYII
SCYGARKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSPRNKNRMMSER
IFIQTLIGRVLADDIYIGSRCVAFRNQDLGIGLVNRLITFGTQSISIRTPFTCRSTSWIC
RLCYGRSPTHGDLVELGEAVGIIAGQSIGEPGTQLTLRTFHTGGVFTGGTAEHVRAPYNG
KIKFNEDLVHPTRTRHGHPAFLCYIDLSVIIESEDIIHSVTIPPKSFLLVQNDQYVESEQ
VIAEIREGTYTFHFKERVRKYIYSDSEGEMHWSTDVSHAPEFTYSNVHLLPKTSHLWILS
GGSCGSSLIRFSIHKDQDQMNIPFLSAERKSISSLSVNNDQVSQKFFSSDFADPKKLGIY
DYSELNGNLGTSHYNLIYSAIFHENSDLLAKRRRNRFLIPFQSIQEQEKEFIPQSGISVE
IPINGIFRRNSIFAFFDDPRYRRKSSGILKYGTLKADSIIQKEDMIEYRGVQKIKTKYEM
KVDRFFFIPEEVHILPESSAIMVQNYSIIGVDTRLTLNIRSQVGGLIRVEKKKKRIELKI
FSGDIHFPDKTDKISRHSGILIPPGRGKKNSKESKKFKNWIYVQRITPTKKKFFVLVRPV
ATYEIADSINLATLFPQDLFREKDNIQLRVFNYILYGNGKPTRGISDTSIQLVRTCLVLN
WDKNSSLEEVRAFFVEVSTKGLIQDFIRIGLVKSHISYIRKRNNSPDSGLISADHMNPFY
SISPKSGILQQSLRQNHGTIRMFLNRNKESQSLLILSSSNCFRMGPFNHVKHHNVINQSI
KKNTLITIKNSSGPLGTATPISNFYSFLPLLTYNQISLIKYFQLDNLKYIFQKINSYLID
ENGIILNLDPYSNVVLNPFKLNWYFLHQNYHHNYCEETSTIISLGQFFCENVCIAKKEPH
LKSGQVLIVQRDSAVIRSAKPYLATPGAKVHGHYSEILYEGDTLVTFIYEKSRSGDITQG
LPKVEQVLEVRSIDSISLNLEKRIKGWNKCITRILGIPWGFLIGAELTIVQSRISLVNKI
QKVYRSQGVQIHNRHIEIIVRQITSKVLVSEEGMSNVFLPGELIGLLRAERTGRALEEAI
CYRAVLLGITRASLNTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAG
TGFNKGLVHCSRQHTNIILEKKTKNLALFEGDMRDILFYHREFCDSSISKSDFSRI
NT seq 4131 nt   +upstreamnt  +downstreamnt
atggcggaacgggccaatctggtatttcacaataaagtgatagatggaactgctattaaa
cgacttattagccgattaatagatcacttcgggatggcatatacatcacacatcctagat
caagtaaagactctgggtttccagcaagccactgctacatccatttcattaggaattgat
gatcttttaacgataccttctaagggctggcttgtccaagatgctgaacaacaaagttgg
attttggaaaaacaccatcattatgggaatgtacatgcggtagaaaaattacgccaatct
attgagatatggtatgctacaagtgaatatttgcgacaagaaatgaatcctaattttagg
atgacggaccccttcaatccagtccatatgatgtctttttcgggagctaggggaaatgca
tctcaagtacatcaattagtaggtatgagaggattaatgtcggatccccaaggacaaatg
attgatttacctattcaaagcaatttacgcgaaggactgtctttaacagaatatattatt
tcttgctatggagcccgtaaaggagttgtagatactgctgtacgcacatcagatgctgga
tatcttacgcgtcgacttgttgaagtagttcaacatattgttgtacgtagaacagattgt
ggcactatccgagggatttcggtgagtcctcgaaataaaaatcggatgatgtcagaaaga
atttttatccaaacattaattggtcgtgtcttagcagacgatatatatataggttcccga
tgtgtcgcctttcgaaatcaagatcttgggattggacttgtcaatcgattaataaccttt
ggaacacaatcaatatccattcgaactccctttacttgtcggagtacatcttggatctgt
cgattatgttatggtcggagtcccactcatggtgacctcgttgaattgggggaagctgta
ggtattatcgcgggtcaatcgatcggcgaaccggggactcaactaacattaagaactttt
cataccggcggagtatttacaggaggtactgccgaacatgtacgagccccttataatgga
aaaatcaaattcaatgaggatttggttcatcctacacgtacacgtcacgggcatcctgcc
tttctatgttatatagacttgtctgtaattattgagagcgaagatattatacatagcgtg
actattccaccaaaaagttttcttttagttcaaaatgatcaatatgtggaatcagaacaa
gtgattgctgagattcgcgagggaacatacacttttcattttaaagagagggttagaaaa
tatatttattctgactcagagggcgaaatgcactggagtactgatgtgtcccatgcaccc
gaatttacatatagtaatgtccacctcttaccaaaaacaagtcatttatggatattatcc
ggaggttcatgtggatctagtctaattcgtttttcgatccataaagatcaagatcaaatg
aatataccctttctttccgccgaaagaaaatctatttctagcctctcagtgaataatgat
caagtgagccaaaaattttttagttccgattttgccgatccaaaaaaattagggatttac
gattattcagaattgaatggaaacttaggtactagtcattataatttaatatattctgct
atttttcatgagaactcggatttattagcaaaaagacgaagaaatagatttctcattcca
ttccaatcgattcaagagcaagagaaagaattcataccgcagtcaggtatctcggttgaa
atacccataaatggtattttccgtagaaatagtatttttgctttttttgatgatcctaga
taccgaagaaagagttccggaattcttaaatatgggactctaaaggcggattcaatcatc
caaaaagaggatatgattgagtatcgaggagtccaaaaaattaagacaaaatacgaaatg
aaagtagatcgcttttttttcattcctgaggaagtgcatattttacccgaatcctctgcc
ataatggtacagaactatagtatcattggagtggatacacgactcactttaaatataaga
agccaagtcggcgggttgatccgagtagagaaaaaaaaaaaaaggattgaactcaaaata
ttttcaggggatatccattttccggacaagacagataaaatatcccgacacagtggcatc
ttgataccgccaggaagaggaaaaaaaaactcgaaggaatccaaaaaatttaaaaattgg
atttatgtccaacggattacaccaaccaagaaaaagttttttgttttggtgcggcccgta
gccacctatgagatagcggacagtataaatttggcaacactcttcccacaagatctcttt
cgggaaaaggataatattcaacttcgagttttcaactatatcctttatggaaatggcaaa
ccaactcgaggaatttctgacacaagtattcaattagttcgaacttgtttagtcttgaat
tgggacaaaaattcttctctcgaggaggtccgtgctttctttgttgaagtaagtacaaag
ggtttgattcaagatttcataagaattggcttagtgaaatcccatatttcatatataaga
aaaaggaataattcgccagattcgggattgatctctgcagatcacatgaatccgttttat
tcgatttcgcccaagtctggcattcttcaacaatcacttagacaaaatcacggaactatt
cgcatgttcttaaatcgaaataaggagtcccaatctttgttaattttatcatcatctaat
tgttttagaatgggtccatttaatcatgtaaaacatcacaatgtgataaaccaatcaata
aaaaaaaatactctaattacaattaaaaattcgtcgggccccttaggaacagctacccca
atttcaaatttttattcgtttttgcctttactaacttataatcagatctctttaattaaa
tattttcaacttgataacttaaaatatatttttcaaaaaattaactcttatttaatcgat
gaaaacggaataattttaaatctcgacccatatagtaacgttgttttgaatccattcaaa
ttgaattggtattttcttcatcaaaattatcatcataattattgtgaggaaacgtccaca
ataattagtcttggacaatttttttgtgaaaatgtatgtatagctaaaaaagaaccgcac
ctaaaatcgggtcaagttttaattgttcaaagggattccgcagtaataagatccgctaag
ccctatttggctactccgggagcaaaagttcatgggcattacagcgaaattctttacgaa
ggggatacattagttacatttatatatgaaaaatcgagatccggtgatataacccaaggt
cttccaaaagtagaacaagttttagaagtccgctcgattgattcaatatcgttgaactta
gaaaagcggattaagggttggaacaagtgtataacaagaattcttggaattccttgggga
ttcttgattggtgctgagttaactatagtgcaaagtcgtatttctttggttaataagatt
caaaaggtttatcgatcccagggggtgcagattcataataggcatatcgaaattattgta
cgtcaaataacatcaaaagttttggtttccgaagagggaatgtctaatgtttttttacct
ggagaacttattggattattacgagcagaacgaacggggcgtgctttagaagaagcaatc
tgttatcgagccgttttattaggaataactcgagcatctttgaatactcaaagttttata
tccgaagcaagttttcaagaaactgctcgagttttagcaaaagctgctcttcggggtcgt
atcgattggttgaaaggcctgaaagaaaatgttgttctagggggggtgatccccgccggg
accggattcaacaaaggattggtgcattgttcacggcaacataccaacattattttggaa
aaaaaaacaaagaatttagctttattcgagggagatatgagagatattttattctaccac
agggaattttgtgactcttctatttccaaatctgacttttctaggatttaa

KEGG   Arabidopsis thaliana (thale cress): ArthCp013
Entry
ArthCp013         CDS       T00041                                 
Symbol
rpoC1
Name
(RefSeq) RNA polymerase beta' subunit
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    ArthCp013 (rpoC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    ArthCp013 (rpoC1)
   03400 DNA repair and recombination proteins [BR:ath03400]
    ArthCp013 (rpoC1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     ArthCp013 (rpoC1)
Transcription machinery [BR:ath03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     ArthCp013 (rpoC1)
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      ArthCp013 (rpoC1)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3
Other DBs
NCBI-GeneID: 844784
NCBI-ProteinID: NP_051050
TAIR: ATCG00180
UniProt: P56763 A0A8F5GHA9
Position
CP:complement(20251..23084)
AA seq 680 aa
MIDRYKHQQLRIGLVSPQQISAWATKIIPNGEIVGEVTKPYTFHYKTNKPEKDGLFCERI
FGPIKSGICACGNYRVIGDEKEDPKFCEQCGVEFVDSRIRRYQMGYIKLTCPVTHVWYLK
RLPSYIANLLDKPLKELEGLVYCDFSFARPITKKPTFLRLRGSFEYEIQSWKYSIPLFFT
TQGFDIFRNREISTGAGAIREQLADLDLRIIIENSLVEWKQLGEEGPTGNEWEDRKIVRR
KDFLVRRMELAKHFIRTNIEPEWMVLCLLPVLPPELRPIIQIEGGKLMSSDINELYRRVI
YRNNTLTDLLTTSRSTPGELVMCQEKLVQEAVDTLLDNGIRGQPMRDGHNKVYKSFSDVI
EGKEGRFRETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLA
SNIGVAKSQIREKKPIVWEILQEVMQGHPVLLNRAPTLHRLGIQSFQPILVEGRTICLHP
LVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHMNLLSPAIGDPISVPTQDMLIGLY
VLTSGTRRGICANRYNPCNRKNYQNERIYETNYKYTKEPFFCNSYDAIGAYRQKKINLDS
PLWLRWQLDQRVIASREVPIEVHYESFGNYHEIYAHYLIVRSVKKENFCIYIRTTVGHIS
FYREIEEAIQGFSQACSYDT
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgatcgatcggtataaacatcaacaactccgaattggcttagtttctcctcagcaaata
agtgcttgggccactaaaataatacctaatggagagatagttggagaggtgacaaaaccc
tatacttttcattacaaaaccaataaaccggaaaaagatggattattttgtgaaaggatt
tttggacctataaagagtggaatttgcgcttgtggaaattatcgagtgatcggagatgaa
aaagaagacccaaagttttgtgaacaatgtggagttgaatttgttgattctcggatacga
agatatcaaatgggatacataaaactgacatgtcctgtaactcatgtatggtatttgaaa
cgtcttcctagttatattgcgaatcttttagataaacctcttaaagaattagaaggccta
gtatactgcgatttttcttttgctaggcccataactaaaaaacctactttcttacgatta
cgaggttcatttgaatatgaaattcaatcctggaaatacagcatcccacttttttttact
actcaaggtttcgatatatttcgaaatcgagaaatttctactggggcgggtgctatccga
gaacaattagccgatttagatttgcgaattattatagaaaattcgttggtagaatggaaa
caattaggagaagaagggcctacggggaatgaatgggaagatcgaaaaattgtaagaaga
aaagattttttagttagacgtatggaattagctaagcattttattcgaacaaatatagaa
cccgaatggatggttttatgtctcttaccggttcttcctcccgagttgagacccatcatt
cagatagaagggggtaaactaatgagttcagatattaatgaactctatagaagagttatc
tatcggaacaatactcttaccgatctattaacaacaagtagatctacaccgggggaatta
gtaatgtgtcaggaaaaattggtacaagaagccgtggatacacttcttgataatggaatc
cgtggacaacccatgagggatggtcataataaggtttacaagtcattttcagatgtaatt
gaaggcaaagagggaagatttcgcgagactctgcttgggaaacgggtcgattattcgggg
cgctcggtgattgtcgttggaccttcactttcattacatcgctgtggattgcctcgcgaa
atagcaatagagctcttccagacatttgtaattcgtggtttaattagacaacacctggct
tcgaacataggagttgctaagagtcaaattcgtgaaaaaaagccgattgtctgggaaatc
cttcaagaagtcatgcaggggcatcccgtattactgaatagagcacctaccctacataga
ttaggcatacagtcattccaacctattttagtggaaggacgcactatttgtttacatcca
ttagtttgtaaggggttcaatgcagactttgatggggatcaaatggctgttcatgtgcct
ttatctttagaggctcaagcagaggctcgtttacttatgttttctcatatgaatctctta
tctccagctattggagatcccatttcggtaccgactcaagatatgcttattggactctat
gtattaacgagcggcactcgtcgaggtatttgtgcaaacagatataatccatgtaatcga
aaaaactatcaaaatgaaagaatttacgaaacaaactataagtatacgaaagaacccttt
ttttgcaattcctatgatgcaattggagcttatcgacagaaaaaaatcaatttagatagt
cctttgtggcttcggtggcaattagatcaacgcgttattgcttcaagagaagttcctatc
gaagttcactatgaatcttttggtaactatcatgagatttatgcacactatctaatagta
agaagtgtaaaaaaagaaaatttttgtatatatattcgaaccacagttggtcatatttct
ttttatcgagaaatcgaggaagctatacaaggtttttctcaagcctgttcatatgatacc
taa

DBGET integrated database retrieval system