KEGG   Arabidopsis thaliana (thale cress): ArthCp014
Entry
ArthCp014         CDS       T00041                                 
Symbol
rpoB
Name
(RefSeq) RNA polymerase beta subunit
  KO
K03043  DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    ArthCp014 (rpoB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    ArthCp014 (rpoB)
   03400 DNA repair and recombination proteins [BR:ath03400]
    ArthCp014 (rpoB)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     ArthCp014 (rpoB)
Transcription machinery [BR:ath03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     ArthCp014 (rpoB)
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      ArthCp014 (rpoB)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_2 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpb2_1 RNA_pol_Rpb2_45
Other DBs
NCBI-GeneID: 844783
NCBI-ProteinID: NP_051051
TAIR: ATCG00190
UniProt: P50546 A0A1B1W4T9
Position
CP:complement(23111..26329)
AA seq 1072 aa
MLGDEKEGTSAIPGFNQIQFEGFYRFIDQGLIEELAKFPKIEDIDHEIEFQLFVETYQLV
EPLIKERDAVYESLTYSSELYVSAGLIWKTSRNMQEQRIFIGNIPLMNSLGTSIVNGIYR
IVINQILQSPGIYYQSELDHNGISVYTGTIISDWGGRLELEIDKKARIWARVSRKQKISI
LVLSSAMGLNLREILENVCYPEIFLSFLTDKEKKKIGSKENAILEFYQQFSCVGGDPIFS
ESLCKELQKKFFHQRCELGRIGRRNINWRLNLNIPQNNIFLLPRDVLAAADHLIGMKFGM
GTLDDMNHLKNKRIRSVADLLQDQLGLALARLENVVKGTISGAIRHKLIPTPQNLVTSTP
LTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSYLGPGGLTGRTANFRIRDIHPSHYGR
ICPIDTSEGINVGLIGSLSIHARIGDWGSLESPFYELFEKSKKARIRMLFLSPSQDEYYM
IAAGNSLALNRGIQEEQAVPARYRQEFLTIAWEEVHLRSIFPFQYFSIGASLIPFIEHND
ANRALMSSNMQRQAVPLSRSEKCIVGTGLERQVALDSGVPAIAEHEGKILYTDTEKIVFS
GNGDTLSIPLIMYQRSNKNTCMHQKPQVRRGKCIKKGQILADGAATVGGELALGKNILVA
YMPWEGYNFEDAVLISECLVYGDIYTSFHIRKYEIQTHVTTQGPERITKEIPHLEGRLLR
NLDKNGIVMLGSWVETGDILVGKLTPQVAKESSYAPEDRLLRAILGIQVSTSKETCLKLP
IGGRGRVIDVRWVQKKGGSSYNPEIIRVYISQKREIKVGDKVAGRHGNKGIISKILPRQD
MPYLQDGRPVDMVFNPLGVPSRMNVGQIFECSLGLAGSLLDRHYRIAPFDERYEQEASRK
LVFSELYEASKQTANPWVFEPEYPGKSRIFDGRTGDPFEQPVIIGKPYILKLIHQVDDKI
HGRSSGHYALVTQQPLRGRSKQGGQRVGEMEVWALEGFGVAHILQEMLTYKSDHIRARQE
VLGTTIIGGTIPKPEDAPESFRLLVRELRSLALELNHFLVSEKNFQINRKEV
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgcttggggatgaaaaagagggaacatctgcaatacccggatttaatcagatacaattt
gaagggttttatcggtttattgatcagggtttaatagaagaacttgctaagtttccaaaa
attgaagatatagatcacgaaattgaatttcaattatttgtggaaacatatcaattggta
gaacctctgataaaagaacgagatgctgtctatgaatcacttacatattcttctgaatta
tatgtatccgcgggattaatttggaaaaccagtaggaatatgcaagaacaaagaattttt
attggaaacattcctttaatgaattcccttggaacttctatagtaaacggaatttaccga
attgtgatcaatcaaatattgcaaagtcccggtatctattaccagtcagaattggatcat
aatgggatttcggtctataccggcaccataatatcagattggggaggcaggttagaatta
gagattgataaaaaagcaagaatatgggctcgggtgagtaggaaacaaaaaatatctatt
ctagttctatcatcagctatgggtttgaatctacgagaaattctagagaatgtttgctac
cctgaaattttcttatctttcttgaccgataaggagaaaaaaaaaataggatcaaaagaa
aatgctattttggagttttatcaacaattttcttgtgtaggtggggatcctatattttct
gaatccttatgtaaggaattacaaaaaaaattctttcaccaaaggtgtgaattaggaagg
attggtcgccgaaatattaattggagactgaatcttaatatacctcagaacaatatattt
ttgttaccacgagatgtgttagcagctgccgatcatttgattgggatgaaatttggaatg
ggtacacttgatgatatgaatcatttgaaaaataaacgtattcgctctgtagcggatctt
ttacaagaccagctcgggttggctctggctcgtttagaaaatgtagttaagggaactatc
tccggagcaattaggcataaattgatacctactcctcagaatttggtaacttcaactccg
ttaacaactacttatgaatcctttttcggattacacccattatctcaagttttggatcga
acaaatccattgacacaaatcgttcatgggagaaaattgagttatttgggccctggcgga
ttaacagggcgaactgctaattttcggatacgagatatccatcctagtcactatgggcgt
atttgtcccattgacacgtctgaaggaatcaatgttggacttattggatctttatcaatt
catgccaggattggtgattgggggtcgttagaaagtccattttatgaactctttgagaaa
tcaaaaaaagcacggatacggatgctttttttatcaccaagtcaagatgaatattatatg
atagcggcaggaaattctttggctcttaatcggggcattcaagaagaacaggctgttcca
gctcgataccgccaagaatttttgactatcgcatgggaagaggttcatcttcgaagcatt
ttccctttccaatatttttccattggagcttctctaattccttttatcgaacataatgat
gcgaatcgagctttaatgagttctaatatgcaacgtcaagcagttccactttctcggtcc
gaaaagtgcattgttggaactgggttggaacgccaagtggctttagattcaggggttccc
gctatagccgaacacgagggaaaaatcctttatactgacactgagaagatcgttttttcg
ggcaatggtgatactctaagcattccattaattatgtatcaacgctcaaacaaaaatact
tgtatgcatcaaaaacctcaggttcgtcggggtaaatgcattaaaaagggacaaatttta
gcggatggtgctgctacagttggtggggaactcgctttggggaaaaatatattagtggct
tatatgccatgggaaggatacaattttgaagatgcggtactcattagtgagtgtctagta
tatggtgatatttatacttctttccacatacggaaatatgaaattcagacgcatgtgaca
acccaaggtcctgaaaggatcactaaagaaataccgcatctagaaggtcgtttactccga
aatttagacaaaaatggaattgtgatgctaggatcgtgggttgaaacaggtgatatttta
gtaggtaaattaacacctcaagtggcgaaagaatcctcctatgctccggaagataggtta
ttacgagctatacttggcattcaggtatcgacttcaaaagaaacttgtttaaaattgcct
ataggtggtagaggtcgagttattgatgtgaggtgggttcagaaaaagggtggttcaagt
tataacccagaaataattcgtgtatatatttcacagaaacgtgaaataaaagtaggtgat
aaagtagctggaagacatggaaataaaggtatcatttcaaaaattttgcctagacaggat
atgccttatttgcaagacgggagacccgtggatatggtcttcaacccattaggagtaccc
tcacgcatgaatgtaggacagatatttgaatgctcgcttgggttagcgggaagtctgcta
gatagacattatcgaatagccccttttgatgagagatatgaacaagaggcttcgagaaaa
ctggtgttttcagaattatatgaagccagtaagcaaacagcgaatccatgggtatttgaa
cccgagtatccaggaaaaagccgcatttttgatggaagaacaggagatccttttgaacag
cctgtgataataggaaagccctatatcttgaaattaattcatcaggttgatgataaaata
cacggacgttctagtggacattatgcacttgttacacaacaaccccttagaggccgttcc
aagcagggggggcagcgggtaggcgaaatggaggtttgggctctggaggggtttggtgtt
gctcatattttacaagagatgcttacttataaatctgatcatattagagctcgccaagaa
gtacttggtaccactatcattggaggaacaatacctaaaccagaagatgctccggaatct
tttcgattacttgttcgagaactacgatctttggctctggaactgaatcatttccttgta
tctgagaagaatttccagattaataggaaggaagtttaa

DBGET integrated database retrieval system