KEGG   Arabidopsis thaliana (thale cress): ArthCp055
Entry
ArthCp055         CDS       T00041                                 
Symbol
rpoA
Name
(RefSeq) RNA polymerase alpha subunit
  KO
K03040  DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    ArthCp055 (rpoA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    ArthCp055 (rpoA)
   03400 DNA repair and recombination proteins [BR:ath03400]
    ArthCp055 (rpoA)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     ArthCp055 (rpoA)
Transcription machinery [BR:ath03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     ArthCp055 (rpoA)
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      ArthCp055 (rpoA)
SSDB
Motif
Pfam: RNA_pol_A_CTD RNA_pol_A_bac RNA_pol_L GAPES3
Other DBs
NCBI-GeneID: 844727
NCBI-ProteinID: NP_051090
TAIR: ATCG00740
UniProt: P56762 A0A1B1W4Y1
Position
CP:complement(77901..78890)
AA seq 329 aa
MVREKVKVSTRTLQWKCVESKRDSKRLYYGRFILSPLMKGQADTIGIAMRRALLGEIEGT
CITRAKSENIPHDYSNIAGIQESVHEILMNLNEIVLRSNLYGTRNALICVQGPGYITARD
IILPPAVEIIDNTQHIATLTEPIDLCIELKIERNRGYSLKMSNNFEDRSYPIDAVFMPVE
NANHSIHSYGNGNEKQEILFLEIWTNGSLTPKEALHQASRNLINLFIPFLHVEEETFYLE
NNQHQVTLPFFPFHNRLVNLRKKKKTKELAFQYIFIDQLELPPRIYNCLKKSNIHTLLDL
LNNSQEDLIKIEHFHVEDVKKILDILEKK
NT seq 990 nt   +upstreamnt  +downstreamnt
atggttcgagagaaagtcaaagtatctactcggacactacagtggaagtgtgttgaatca
aaaagagacagtaagcgtctttattatggacgctttattctgtctccacttatgaaaggc
caagccgacacaataggcattgcgatgcgaagagctttacttggcgaaatagaaggaaca
tgtattacacgtgcaaaatctgagaacataccacatgactattctaacatagcaggtatt
caagaatcagtacatgaaattttaatgaatttgaacgagattgtattaagaagtaatcta
tatggaacgcgcaacgcgcttatttgtgtccaaggtcctggatatataactgctcgagac
attattttaccgcccgctgtggaaatcattgataatacacagcatatagctaccttaaca
gaaccaatagatttgtgtattgaattaaaaattgagaggaatcgcggatatagtctaaaa
atgtcaaataactttgaagacagaagttatcctatcgatgctgtattcatgcctgttgaa
aatgccaatcatagtattcattcttatgggaatgggaatgaaaaacaagagattcttttt
ctagaaatatggacaaatggaagtttaactcctaaagaagcacttcatcaagcctcccgg
aatttgattaatttatttattccttttctacatgtagaagaagaaacgttctatttagag
aacaatcaacatcaagttactttacccttttttccttttcataatcgattagttaaccta
agaaaaaaaaaaaaaacaaaagaactagcctttcaatatatttttattgaccaattagaa
ttgcctcccagaatctacaattgtctcaaaaaatccaatatacatacattattggacctt
ttgaataacagtcaagaagaccttatcaaaattgaacattttcacgtagaagatgtaaaa
aagatattagacattctagaaaaaaaatag

DBGET integrated database retrieval system