KEGG   Aegilops tauschii (wheat D): 109733276
Entry
109733276         CDS       T04345                                 

Name
(RefSeq) cytochrome P450 93A2-like
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00941  Flavonoid biosynthesis
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    109733276
   00943 Isoflavonoid biosynthesis
    109733276
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ats00199]
    109733276
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     109733276
Cytochrome P450 [BR:ats00199]
 Cytochrome P450, plant type
  CYP93 family
   109733276
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109733276
NCBI-ProteinID: XP_020148060
Position
Unknown
AA seq 550 aa
MATASSMQQPALLLLRQLTQDPVTASLLAVALATAVLMIAALSRGGGRKPRLPPSPRGFP
VIGHLHLVRPPVHRTFHDLAARLGPLMHIRLGSTHCVVASSAGVAAELIRTHEGKISERP
LTAVARQFAYGDDGFAFAPYGPHWRSMKRLCMSELLGPRTVEQLRPVRRAGLVSLLQSVL
HQASGAEAVDLTAALIRLSNTSIIRMMASTVPGSVTGEAQALVKAVAELVGAFNVEDYIA
VCRGWDLQGLGRRAADVHRRFDALLEQMIRHKEEAREARKMRGGAEGETPEKKTATGTTT
ESSKDLLDILLDKLEDDAAAEVKLTRKKIKAFVIDVVTAGSDTSAAMVEWMLAELMNHPE
CLRKVREEIDAVVGRDRIAGEGDVASLPYLQAAYKETLRLRPAAPIAHRQSTEEMVVTAA
GGVGGFTVPAGTAVFMNLWSIARDPANWDAPLEFRPERFMAGGRNEALDPRGQHFQYLPF
GSGRRGCPGMGLALQSVPAVVAALVQCFDWAVDGDAKKIDMEEADGLVCARKHPLLLRPS
PRLSPFPAVV
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggcaacggcgtcgagcatgcagcagccggcgctgcttcttcttcggcagctgacgcag
gacccagtgacggcctccctcctcgcggtcgcgctcgccaccgcggtccttatgatcgcc
gccttgagcagaggcgggggccggaagccgcggctgccgccgagcccgaggggcttcccg
gtgatcgggcacctgcacctggtgcgcccgccggtgcaccgcaccttccacgacctggcg
gcccggctgggcccgctgatgcacatccggctcggctccacccactgcgtggtggccagc
tcggccggcgtcgccgccgagctcatccggacccacgagggcaagatctcggagcggccg
ctcacggccgtggcgcgccagttcgcgtacggcgacgacggcttcgccttcgcgccctac
ggcccgcactggcgctccatgaagcgcctctgcatgtccgagctcctcggcccccgaacc
gtcgagcagctccgccccgtccgccgcgccggcctcgtctcgctgctgcagagcgtgctg
caccaggcgtcgggtgctgaggcggtggacctcaccgccgcgctcatccggctgtcgaac
acgtccatcatcaggatgatggccagcaccgtgcccgggagcgtcacgggggaggcgcag
gcgctggtcaaggccgtggcggagctcgtcggtgcgttcaacgtcgaggattacatcgcc
gtgtgccgcggctgggacctccagggcctcggccgccgggccgccgacgtccaccgccgc
ttcgacgcgctgctcgagcagatgattcggcacaaggaggaggcccgggaggccaggaag
atgcgtggtggagcagaaggagagacgccggagaagaagacagccacgggaacgacgacg
gagagcagcaaggacttgctcgacatcctgctggacaagttggaggacgacgcggcggcg
gaggtgaagctcaccaggaagaagatcaaagccttcgtcatcgacgtggtgaccgccggc
tccgacacgtcggcggccatggtggagtggatgctggcggagctgatgaaccacccggag
tgcctccgcaaggtgcgggaggagatcgacgcggtggtggggcgcgacaggatcgcgggc
gagggcgacgtggcgagcctcccctacctgcaggcggcgtacaaggagacgctccgactg
cgcccggcggccccgatcgcgcaccggcagtcgacggaggagatggtggtgaccgcggcc
ggcggcgtaggcgggttcacggtgcctgcgggcacggcggtgttcatgaacctgtggtcc
atcgcgcgcgacccggccaactgggacgcgccactggagttccggcctgagcggttcatg
gccggcgggcgcaacgaggcgctggacccgcgcgggcagcacttccagtacctgccgttc
gggagcggccggcgcggctgccccggcatggggctcgcgctccagtccgtgcccgccgtc
gtggcggccctcgtgcagtgcttcgactgggccgtggacggcgacgcgaagaagatagac
atggaggaggccgacgggctggtgtgcgcgcgcaagcacccgctgctgctccgcccctcg
ccgcgcctcagccccttcccggcggtcgtctag

DBGET integrated database retrieval system