KEGG   Aegilops tauschii (wheat D): 109753210
Entry
109753210         CDS       T04345                                 

Definition
(RefSeq) cytochrome P450 71C3-like
  KO
K13226  2-hydroxy-1,4-benzoxazin-3-one monooxygenase [EC:1.14.14.110]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00402  Benzoxazinoid biosynthesis
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00402 Benzoxazinoid biosynthesis
    109753210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ats00199]
    109753210
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.110  2-hydroxy-1,4-benzoxazin-3-one monooxygenase
     109753210
Cytochrome P450 [BR:ats00199]
 Cytochrome P450, plant type
  CYP71 family
   109753210
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109753210
NCBI-ProteinID: XP_020167719
Position
Unknown
AA seq 523 aa
MALEAAHHYLQLAVGHGTSTPAVLLIVVVPLLMLVLVSVRTSASTRKLRLPPSPPGSLPI
IGHLHHIGAQTHISLQHLVDKYGHNGLLFLRAGAVPTVIVSSPSAAEAVMRTHDHILASR
PWSMASHILRYNTTDVAFSPLGEYWQHTRKLVNTHLLSAKKVHSFRHGRQEEVCLVVNKI
REAATNAPSTAVDMSEFLAAYTNDVVSRSVLGATHRKKGRNTLFREMTETNVDLLVGFNL
ENFIPRWPLTEVLFRLVCWKVQRHLNKWDALLEEVIKEHINLKQDNSADFIHVFLSLQQE
YGLTDDNVKSLLMNIFEAAIETSYLVLEYAMAELINNRHVMKKLQTEVRTFASSKGKRLD
MITEEDLSSLPYLKATMKEALRLHPPGPLLLPHYSTADCNIDGYDIPAKTRILVNGWAIG
RDPTAWQRPEDFMPERFLQDGQEKSSNLGQDLKYLPFGSGRRICPGANFALATMEIMLVN
LMYHFDWEVPNEKEGTGGKVSMAETFGLMLRRNEKLYLVPKIV
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctcttgaagctgcccaccactacctgcagctcgccgtcggccatggcacatccacg
ccggcggtactcctcatcgtcgttgttcccttactgatgttagtgctagtatcagtaaga
acatcagcgtccacaagaaagctgcggctcccgccttcgcctccgggcagccttcccatc
atcggccacctccaccacatcggcgcccagacccacatctccctgcagcacctggtcgac
aagtacggccacaacggtctcctcttcctccgcgccggcgccgtgcccaccgtcatcgtc
tcctcgccaagcgccgccgaggccgtcatgcgcacccacgaccacatcctcgcgtcgcgc
ccgtggtccatggcctcgcacatccttcgctacaacaccaccgacgtcgccttctcgccc
ttgggcgagtactggcagcacacccggaagctcgtcaacacgcacctgctcagtgccaag
aaggtgcactccttccgccatggccgtcaagaagaggtgtgcctcgtcgtcaacaagatt
cgtgaggcggccaccaacgctccatccacggcggtggacatgagcgagttcctggccgcc
tacaccaatgacgtcgtaagccgctcggtgctgggagcgacccacaggaagaaaggccgc
aacacgctcttcagagagatgaccgagaccaacgtcgaccttctcgtgggattcaacctt
gagaacttcatccctaggtggccactgacggaggtgctcttcaggctggtctgctggaag
gttcagcgacacctcaacaagtgggacgccttgctggaagaggtcatcaaggagcacata
aacttgaagcaagataattctgccgacttcatccatgttttcctctctctacagcaagag
tacggtctcacggacgataatgtcaagtccctcttgatgaacatatttgaggcagctata
gaaacatcgtatctggtgctggaatacgccatggccgagcttataaacaacagacatgtt
atgaagaaactacaaaccgaggtaaggacgtttgcatcgtccaagggcaaaaggttggac
atgattacggaggaggacctcagcagcctgccctacctaaaggcaactatgaaagaggcc
ctccgcttgcacccaccagggcctttactcctcccacactactccactgctgactgcaac
attgacggatacgacatacccgccaaaacacgtatccttgtgaacggttgggccattgga
agagacccaacagcttggcagaggccagaggatttcatgccggagaggttcctacaagat
ggccaggagaaatctagcaacctgggtcaagatttgaagtatctgccatttggatccgga
cgtaggatttgccccggggcaaattttgcgctcgcgacaatggagattatgctagtaaat
ctcatgtaccattttgactgggaggttcccaatgagaaagagggtactggtggaaaggtt
agtatggccgagacattcgggctgatgcttcgccgaaatgagaaactctaccttgttcca
aagattgtctaa

DBGET integrated database retrieval system