KEGG   Aegilops tauschii (wheat D): 109777288
Entry
109777288         CDS       T04345                                 

Definition
(RefSeq) cytochrome P450 93A3-like
  KO
K23135  flavanone 2-hydroxylase [EC:1.14.14.162]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ats00199]
    109777288
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.162  flavanone 2-hydroxylase
     109777288
Cytochrome P450 [BR:ats00199]
 Cytochrome P450, plant type
  CYP93 family
   109777288
Motif
Pfam: p450 DUF2514 META
Other DBs
NCBI-GeneID: 109777288
NCBI-ProteinID: XP_020191526
Position
Unknown
AA seq 514 aa
MDQLGVGVVSDSVAPWLVASLLAAVAFFLLTLVRHGGKQGRLPPSPMALPFIGHLHLIRP
PPHRAFDRIINRYGPLVYLRLGPSTHCVVIGSADVARDVLKFEGSIPERPLTAVTRHLAY
DSAGFAFAPYGPHWRFMKRLCMSELLGPRTIEQLRPVRAAELAGVMRAAAEAAAKGETVD
MSRQLIRMSNNAIMRMVASALPGDMADTARDCAKKVAELVGAFNLEDYVALCRGWDLQGL
DRKTRDVRDRFDALLESMIRTKEKERREEADETKTKAKDLLDILMDAAADPAAEVKLTRD
NIKAFIIDIFTAGSDTTATTVEWMLADLLNHPDCLQKLRAELDAVVGRSRVVGEPDVAQM
PYLQAVLKETLRLRPPAVFAQREAIEPIHVRGYTIPVKTSVFFNIFSIGRDAAYWEEPLE
FRPERFMPGGAGEAVDPKGQHMQLMPFGSGRRACPGMGLAMQAVPAFLAALVQCFDWEVP
NPPLDMEEEAGLVTARKQPLVLLPTQRLHPLPLP
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggaccaactcggagtcggagtagtctcggacagtgtagcgccatggcttgtggcctcg
ctcctcgccgccgtcgccttcttcctcctcacgctggtcagacatggcggcaagcagggt
cgcctccccccgagccccatggcacttccgttcatcggccacctccacctcatccgcccg
cctccccaccgcgccttcgaccgcatcattaaccgctacggcccgctcgtgtacctccgc
cttggcccctccacccactgcgtcgtcatcggctctgccgacgtcgcccgcgacgtcctc
aagttcgagggcagcatcccggagcgcccgctcacggcggtcacgcggcacctcgcctac
gactcggccggcttcgccttcgcgccctacggcccgcactggcgcttcatgaagcgcctc
tgcatgtcggagctgctcggcccgcgcaccatcgagcagctgcgccccgtccgcgccgcc
gagctcgcgggcgtcatgcgcgcggcggcggaggcggccgccaagggcgagaccgtggac
atgagcaggcagctcatccgcatgtccaacaacgccatcatgaggatggtggcgagcgcg
ctgcccggcgacatggccgacacggctcgggactgcgccaagaaggtggcggagctggtg
ggcgcgttcaacttggaggactacgtggcgctgtgccgcggctgggacctgcaggggctc
gaccggaagacgcgcgacgtgcgcgacaggttcgacgcgctgctcgaatccatgatcagg
accaaggagaaggagcggcgtgaggaagcagacgagaccaagaccaaggccaaggacttg
cttgacattctcatggacgcggcggccgacccggccgccgaggtcaagctcacccgggac
aacatcaaggcgttcatcatcgacatcttcactgccgggtcggacacgacagccaccacc
gtggagtggatgctggcagatctgctcaaccacccggactgcctgcagaagctgcgggcg
gagctggatgccgtggtgggcaggtcccgggtggtgggcgagccggacgtggcccagatg
ccatacctgcaggcggtgctcaaggagaccctgcggctgcggccgccggcggtgttcgcg
cagcgggaggcgatcgagcccatacacgtccgtgggtacaccatccctgtcaagacgtcg
gtcttcttcaacatcttctccatcgggcgcgacgcggcgtactgggaggagccgctcgag
ttccggccggagcggttcatgcccggcggcgccggcgaggccgtggaccccaaggggcag
cacatgcagctcatgccgttcgggagcgggcggcgcgcctgccccggcatggggctggcc
atgcaggccgtgccggcgttcctggccgcgctggtgcagtgtttcgactgggaggtgcca
aatccgccgctggacatggaggaggaggcggggctggtcaccgcgaggaagcagccgctc
gtgctcctgcccacgcagcgcctccatccactgccccttccttaa

DBGET integrated database retrieval system