KEGG   Agrobacterium vitis: Avi_7458
Entry
Avi_7458          CDS       T00851                                 

Name
(GenBank) conserved hypothetical protein
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
avi  Agrobacterium vitis
Brite
KEGG Orthology (KO) [BR:avi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:avi02000]
    Avi_7458
Transporters [BR:avi02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Avi_7458
SSDB
Motif
Pfam: LysE TerC LptF_LptG DPM3
Other DBs
NCBI-ProteinID: ACM40100
UniProt: B9K5F2
Position
pAtS4e:complement(424178..424789)
AA seq 203 aa
MELTLILKSIVLGLAVAAPLGPIGALCINRTLERGFWAGVAGGFGTALADAVYASLAALG
FSAFAATLATIDTPLKIIGGLFMVWLGWKSLKPKPLADAAKVGARDLFGTIAATFFLTIT
NPVTILSFAAIFAGLGLADASGTTNAFFVVAGVFLGSLLWWFLLSGGIALARQRLPPSFA
RWVSCLSGLILISFGLFALGSIA
NT seq 612 nt   +upstreamnt  +downstreamnt
atggagctgacactcattttgaaaagcattgtgcttggccttgctgtcgcagccccgctc
ggccccatcggcgccttgtgcatcaaccggactcttgaacgtgggttctgggccggggtg
gcgggcggctttgggactgctctggcggatgccgtctacgccagtctcgctgcgcttggc
ttttccgctttcgcggcgacccttgcgacaatcgatacgccgctcaaaatcatcggtgga
cttttcatggtgtggctcggctggaaaagcctgaagcccaaacctctcgcggacgcggcc
aaggtcggagcgcgcgatcttttcggtaccatcgctgcaacctttttcctgacgattacc
aaccctgtgaccattctgtcctttgctgcaatttttgccggtcttggccttgctgacgca
tcggggacgacaaatgcgtttttcgtggtcgcaggcgttttccttggctcgttgctgtgg
tggttcctactgagtggcggcattgcattggcgcgacagcgtcttcccccaagttttgcc
cgctgggtttcctgtttgtctggactgatactgatctcgttcggactttttgccctcggt
tcaatcgcttga

DBGET integrated database retrieval system