KEGG   Bacillus sp. BS34A: BS34A_22110
Entry
BS34A_22110       CDS       T03833                                 
Symbol
sspC
Name
(GenBank) small acid-soluble spore protein C
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bacl  Bacillus sp. BS34A
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BS34A_22110 (sspC)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: CEJ77626
Position
I:2174253..2174471
AA seq 72 aa
MAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQNMGGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atggctcaacaaagtagatcaagatcaaacaacaataatgatttactaattcctcaagca
gcttcagctattgaacaaatgaaacttgaaatagcttctgagtttggtgttcaattaggc
gctgagactacatctcgtgcaaacggttcagttggtggagaaatcactaaacgtttagtt
cgcttagctcaacaaaacatgggcggtcaatttcattaa

DBGET integrated database retrieval system