KEGG   Bacillus sp. SDLI1: AUL54_00200
Entry
AUL54_00200       CDS       T05207                                 
Name
(GenBank) spore protein
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bacs  Bacillus sp. SDLI1
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    AUL54_00200
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: AME04853
UniProt: A0A0X8KD12
Position
complement(24419..24637)
AA seq 72 aa
MAQQNRSRSNNNNELVVPQAASAIEQMKYEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQSMNGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atggctcaacaaaacagatcaagatcaaacaataataatgagttagttgtaccgcaagct
gcttcagcaattgaacaaatgaaatatgagattgcttctgaatttggtgttcaattgggc
gctgagacaacaagtagagcaaacggatcagtaggtggagagattacaaagcgtttggtt
cgcttagctcaacaaagtatgaatgggcaatttcattaa

DBGET integrated database retrieval system