Bacillus sp. WP8: QR42_12655 Help Entry QR42_12655        CDS       T03530                                  Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism bacw  Bacillus sp. WP8 Brite KEGG Orthology (KO) [BR:bacw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bacw03110]     QR42_12655 Chaperones and folding catalysts [BR:bacw03110]  Protein folding catalysts   Protein disulfide isomerase    QR42_12655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_3 Thioredoxin_9 Redoxin AhpC-TSA TraF HyaE Glrx-like Glutaredoxin OST3_OST6 Thioredoxin_7 DUF4788 Motif Other DBs NCBI-ProteinID:  AIZ61077 Position complement(2515486..2515800) Genome browser AA seq 104 aa AA seqDB search MAIVKATDATFSQETAEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKMKIVKIDVDDN QETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALAELVNKHL NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaatcgtaaaagctactgacgcaacattttcacaagaaactgcagaaggtgttgtt cttgcagacttttgggcaccatggtgtggaccttgtaaaatgattgctccagttcttgaa gaacttgatcaagaaatgggcgacaaaatgaaaattgtaaaaattgatgtagacgataac caagaaactgctggtaaatacggcgttatgagtatcccaacacttcttgttttaaaagac ggtgaagttgtagaaacttctgttggtttcaaaccaaaagaagcacttgctgaacttgtc aacaaacatctataa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (14) Pfam (14) All databases (16) Download RDF

DBGET integrated database retrieval system