Bacillus sp. FCW2: K3G25_17915 Help Entry K3G25_17915       CDS       T10657                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism bafc  Bacillus sp. FCW2 Brite KEGG Orthology (KO) [BR:bafc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:bafc03400]     K3G25_17915 Enzymes [BR:bafc01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      K3G25_17915 DNA repair and recombination proteins [BR:bafc03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     K3G25_17915  Prokaryotic type     K3G25_17915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Nudt16-like NUDIX_4 Motif Other DBs NCBI-ProteinID:  UHC64580 Position complement(3627423..3627728) Genome browser AA seq 101 aa AA seqDB search MEEVKVVYALIRNEFNQIVMVDNHEGHWSLPGGKVELNENLIEAAVREVYEETGLEVEIG DILAVNEAKFTLLLEHTRTFRCVFIVVFISEMWLFTYIDFP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggaagaagttaaagttgtatacgcattgattagaaatgagttcaatcagatagtaatg gtagataatcatgaggggcattggtcacttccaggcggaaaagttgagcttaatgaaaat ctaatagaagcagctgtacgtgaggtatatgaagaaacagggctggaagttgaaattggg gatatactagctgttaatgaagcgaaatttacattattattggagcacaccagaacattc aggtgtgtttttattgttgtattcatttctgaaatgtggttattcacttatatcgatttc ccataa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system