KEGG   Bacillus velezensis UCMB5033: RBAU_2001
Entry
RBAU_2001         CDS       T02795                                 
Symbol
sspC
Name
(GenBank) small acid-soluble spore protein (alpha/beta-type SASP); SPbeta phage protein
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bama  Bacillus velezensis UCMB5033
Brite
KEGG Orthology (KO) [BR:bama00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    RBAU_2001 (sspC)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: CDG29969
UniProt: S6FLG0
Position
2154856..2155074
AA seq 72 aa
MAQQNRSRSNNNNELVVPQAASAIEQMKYEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQSMNGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atggctcaacaaaacagatcaagatcaaacaataataatgagttagttgtaccgcaagct
gcttcagcaattgaacaaatgaaatatgagattgcttctgaatttggtgttcaattgggc
gctgagacaactagtcgagcaaacggatcagtaggtggagaaattacaaaacgtttggtt
cgactggctcaacaaagcatgaatggtcaatttcattaa

DBGET integrated database retrieval system