KEGG   Bacillus velezensis SQR9: V529_19960
Entry
V529_19960        CDS       T03384                                 
Name
(GenBank) small acid-soluble spore protein
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bamy  Bacillus velezensis SQR9
Brite
KEGG Orthology (KO) [BR:bamy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    V529_19960
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: AHZ16022
Position
2137554..2137766
AA seq 70 aa
MAKQNRSNNSNELLVPQAAGALEQMKYEIASEFGVNLGPETTSRANGSVGGEITKRLVRL
AQQSMNGQFH
NT seq 213 nt   +upstreamnt  +downstreamnt
atggctaaacaaaacagatcaaacaacagcaatgaattacttgtgcctcaagctgctggt
gctcttgaacaaatgaagtatgaaattgcttctgagttcggtgtgaacttagggcctgag
acaacaagtagagcaaacggatcagtaggtggagagatcacaaaacgtttagtacgttta
gctcaacaaagcatgaatggccaatttcattaa

DBGET integrated database retrieval system