KEGG   Brevibacillus brevis: BBR47_18260
Entry
BBR47_18260       CDS       T00879                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00471  D-Glutamine and D-glutamate metabolism
bbe00550  Peptidoglycan biosynthesis
bbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BBR47_18260 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBR47_18260 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbe01011]
    BBR47_18260 (murC)
Enzymes [BR:bbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BBR47_18260 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:bbe01011]
 Precursor biosynthesis
  Amino acid ligase
   BBR47_18260 (murC)
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C DELLA
Other DBs
NCBI-ProteinID: BAH42803
UniProt: C0ZAJ4
Position
1920895..1922277
AA seq 460 aa
MDQAQHVHFVGIGGYGMSAIARVLIDLGYKVTGSDVAMNDLAKKLEARGAVIHIGHNAAH
VEGADSIVYSTSISKDNPEVIAGQALGIPVMHRSQMLARILNERTGVAVAGAHGKTTTTS
MISHVLEECGVDPTFIIGGELMSAGTNAKAGTSDYVIAEADESDGSFLEYRPMYEIVTSI
EPDHLEHFDGDFNNLKQAYVQFLSHLKPDGKAILCIDDSHVREVMPSVEKTVVTYAVDPN
FVAQAQFSATSIECGDRCSTCQVYHKDERLGELCLVVPGKHNIANALAAIVVCLDIGLSF
DKIAQALSTFSGAKRRFQIIGDARGVLVVDDYAHHPTEIIATLSGARASGRRVIAVFQPQ
RYTRTYFLMDEFSRAFAEADEVIITDIYSPAGEEKIEGVTSEVLVQKIRTNSHPRAQYIP
TKEQMQEHVFKELQEGDLVLTMGAGDIWKSAYWLAEKLEK
NT seq 1383 nt   +upstreamnt  +downstreamnt
gtggatcaggcccaacacgtccactttgtgggcatcggcggttatggcatgagtgccatt
gcccgcgtcttgatcgaccttggatacaaggtaaccggctccgatgtcgccatgaacgat
ttggcgaaaaagctggaagcaagaggggcggtcattcatattggccataatgctgcccac
gtggagggagcagacagcatcgtatactccaccagtatttctaaagacaatcctgaggtg
atcgcaggccaagcactaggaattccggtcatgcaccgttcccaaatgcttgctcgcata
ttgaatgaacgcacaggagtagcagtagcgggagcacacggcaagacgaccacgacatcg
atgatctctcacgtactggaagagtgcggtgtagacccgactttcatcattggcggtgaa
ttgatgagtgctggtaccaacgcaaaggcaggtaccagtgattatgttattgccgaagca
gatgagagcgacggttcctttttggaatacaggccgatgtatgaaattgtgacgagcatc
gaaccagatcatctcgagcatttcgatggcgacttcaacaatttgaaacaggcgtatgtc
cagttcttgagccatctcaaaccggatggaaaagcgatcctgtgtatcgatgattcacat
gtgcgcgaagtcatgccgtccgtcgaaaaaacggtcgtgacgtatgcagttgatccgaac
tttgtggcacaagcacagttttctgccacttcgattgaatgtggagatcgttgcagcacg
tgccaggtttatcacaaggatgagcggttgggtgaattgtgtctcgtagtcccaggcaag
cataatattgcaaatgcactagctgcgatcgttgtatgtctggatattggcctttccttt
gataaaattgcacaggcgctgtctacctttagcggtgccaagcgcagatttcaaattatc
ggggatgcacgaggcgtcctggtcgtagacgactacgcgcatcatccgacagaaattatc
gcgacacttagtggggcaagagcatcgggcagacgtgtaatcgctgtgtttcagccacaa
cgctatacacgcacgtatttccttatggatgaattcagccgtgcctttgcagaagcagac
gaagtgatcatcacggacatctactccccggctggcgaagaaaaaatcgaaggagttacc
tccgaggtgctggttcaaaaaatccgcaccaacagccacccgcgtgcgcagtacattcct
acaaaggaacaaatgcaggagcatgtcttcaaagaattgcaagagggcgacctcgtgttg
acaatgggtgcaggagacatttggaaatctgcatattggctggctgaaaagctagagaaa
taa

DBGET integrated database retrieval system